Search results for "ICON"

showing 10 items of 3539 documents

Relation between Sexual Dysfunctions and Epilepsy, Type of Epilepsy, Type of Antiepileptic Drugs: A Prospective Study

2017

Introduction The aim of this study was to evaluate the incidence of sexual dysfunctions in males with epilepsy, the type of epilepsy, the frequency of seizures, the type of antiepileptic drugs (AEDs), the serum hormonal profile and the presence of psychiatric comorbidity. Methods Sixty-one patients focused on type of epilepsy, frequency of seizures, AEDs, hormonal profile and presence of mood disorders. We excluded all patients with severe neurologic and psychiatric impairment and patient who were not able to fill questionnaires. Mean age was 31.2 years (range 18-50 years); 31 patients (50.8%) had an idiopathic generalised epilepsy and 30 (49.2%) a focal epilepsy; among them, latter 18 (60%…

AdultMalemedicine.medical_specialtyPediatricsAdolescentSexual dysfunctionSettore MED/24 - UrologiaYoung Adult03 medical and health sciencesEpilepsyTestosterone blood0302 clinical medicinemedicineHumansTestosteroneSex hormonesProspective StudiesSexual Dysfunctions PsychologicalYoung adultProspective cohort studyPsychiatryEpilepsybusiness.industryIncidenceIncidence (epidemiology)Testosterone (patch)General MedicineCarbamazepineMiddle Agedmedicine.disease030227 psychiatrySexual Dysfunction PhysiologicalCarbamazepineSexual dysfunctionAnticonvulsantsSettore MED/26 - Neurologiamedicine.symptombusiness030217 neurology & neurosurgerymedicine.drugUrologia Journal
researchProduct

Analysis of thiamine transporter genes in sporadic beriberi

2014

Abstract Objective Thiamine or vitamin B 1 deficiency diminishes thiamine-dependent enzymatic activity, alters mitochondrial function, impairs oxidative metabolism, and causes selective neuronal death. We analyzed for the first time, the role of all known mutations within three specific thiamine carrier genes, SLC19 A2, SLC19 A3 , and SLC25 A19 , in a patient with atrophic beriberi, a multiorgan nutritional disease caused by thiamine deficiency. Methods A 44-year-old male alcoholic patient from Morocco developed massive bilateral leg edema, a subacute sensorimotor neuropathy, and incontinence. Despite normal vitamin B 1 serum levels, his clinical picture was rapidly reverted by high-dose in…

AdultMalemedicine.medical_specialtySLC19 A- SLC25 A19SLC19 AEndocrinology Diabetes and MetabolismGene mutationBeriberimedicine.disease_causeMitochondrial Membrane Transport Proteinslaw.inventionBeriberilawInternal medicineGenotypemedicineThiamine transporterObjective: Thiamine or vitamin B1 deficiency diminishes thiamine-dependent enzymatic activity alters mitochondrial function impairs oxidative metabolism and causes selective neuronal death. We analyzed for the first time the role of all known mutations within three specific thiamine carrier genes SLC19 A2 SLC19 A3 and SLC25 A19 in a patient with atrophic beriberi a multiorgan nutritional disease caused by thiamine deficiency. Methods: A 44-year-old male alcoholic patient from Morocco developed massive bilateral leg edema a subacute sensorimotor neuropathy and incontinence. Despite normal vitamin B1 serum levels his clinical picture was rapidly reverted by high-dose intramuscular thiamine treatment suggesting a possible genetic resistance. We used polymerase chain reaction followed by amplicon sequencing to study all the known thiamine-related gene mutations identified within the Human Gene Mutation Database. Results: Thirty-seven mutations were tested: 29 in SLC19 A2 6 in SLC19 A3 and 2 in SLC25 A19. Mutational analyses showed a wild-type genotype for all sequences investigated. Conclusion: This is the first genetic study in beriberi disease. We did not detect any known mutation in any of the three genes in a sporadic dry beriberi patient. We cannot exclude a role for other known or unknown mutations in the same genes or in other thiamine-associated genes in the occurrence of this nutritional neuropathy.HumansThiamineGenePolymerase chain reactionGeneticsMutationNutrition and DieteticsbiologyMembrane Transport ProteinsThiamine Deficiencymedicine.diseaseAlcoholismEndocrinologyMutationbiology.proteinThiamineMutations
researchProduct

Focal breast lesion characterization according to the BI-RADS US lexicon: role of a computer-aided decision-making support

2018

Objectives: to assess the diagnostic performance of a computer-guided decision- making software (S-Detect) in the US characterization of focal breast lesions (FBLs), according to the radiologist's experience. Materials and Methods: 300 FBLs (size: 2.6-47.2 mm; mean: 13.2 mm) in 255 patients (mean age: 51 years) were prospectively assessed in consensus according to BIRADS US lexicon by two experienced radiologists without and with S-Detect; to evaluate intra and inter-observer agreement, the same 300 FBLs were independently evaluated by two residents at baseline and after 3 months. Results: 120/300 (40%) FBLs were malignant, 2/300 (0.7%) high-risk and 178/300 (59.3%) benign. Experts review s…

AdultMalemedicine.medical_specialtySupport Vector MachineAdolescentdiagnosisBI-RADSBreast lesionneoplasmsBreast NeoplasmsBI-RADSLexiconComputer aidedBreast Neoplasms MaleDecision Support Techniques030218 nuclear medicine & medical imagingDiagnosis Differential03 medical and health sciences0302 clinical medicinePredictive Value of TestsmedicineHumansRadiology Nuclear Medicine and imagingDiagnosis Computer-AssistedBreastBI-RADS; breast; computer aided; diagnosis; neoplasms; ultrasonographyAgedNeuroradiologyUltrasonographyAged 80 and overmedicine.diagnostic_testbusiness.industryInterventional radiologyGeneral MedicineMiddle Aged030220 oncology & carcinogenesisComputer-aidedNeoplasmFemaleUltrasonography MammaryRadiologyUltrasonographybusinessSettore MED/36 - Diagnostica Per Immagini E RadioterapiaDiagnosi
researchProduct

Long-term results of the use of silicone sheets after diskectomy in the temporomandibular joint: clinical, radiographic and histopathologic findings

1999

The aim of the present study was to evaluate the long-term results of a group of patients who had the disk of the temporomandibular joint (TMJ) removed and permanently replaced by a silicone sheet. The study group comprised 48 patients, treated in the period from 1983 to 1993. In eight patients, the implants had to be removed after an average interval of 5.6 years and they were submitted for histopathological examination. Twenty-five of the 40 patients with silastic implants in place, and five of the 8 patients who had their implants removed, were available for long-term follow-up (mean interval of 7.0 years, SD 2.8 years). Clinical function was rated according to the Helkimo Dysfunction In…

AdultMalemedicine.medical_specialtyTime FactorsJoint ProsthesisRadiographySiliconesPalpationCondylechemistry.chemical_compoundSiliconeRadiography PanoramicTemporomandibular Joint DiscmedicineHumansDimethylpolysiloxanesDiskectomyDevice RemovalAgedChi-Square Distributionmedicine.diagnostic_testPolyethylene Terephthalatesbusiness.industryMiddle AgedSilasticProsthesis FailureTemporomandibular jointSurgerymedicine.anatomical_structureOtorhinolaryngologychemistryFemaleSurgeryHistopathologyOral SurgerybusinessFollow-Up StudiesInternational Journal of Oral and Maxillofacial Surgery
researchProduct

Shock-wave therapy for tennis and golfer's elbow - 1 year follow-up

1999

Thirty patients with chronic medial epicondylitis were treated with low-energy shock waves. They received 500 impulses of 0.08 mJ/mm2 three times at weekly intervals. At 1 year follow-up examinations were performed. According to the Verhaar criteria, only seven patients reached excellent or good results. In eight cases a fair outcome was recorded, and in 14 patients the outcome was poor. Only six patients were satisfied with the treatment. The average relief of pain was 32%. These data were significantly worse than for identically treated patients with chronic tennis elbow. Thus, the question arises as to whether extracorporal shock-wave therapy is indicated in medial epicondylitis.

AdultMalemedicine.medical_specialtyUltrasonic TherapyElbowTennis injuriesElbow JointmedicineTennis elbowHumansGolfer's elbowOrthopedics and Sports MedicineRange of Motion ArticularAgedPain MeasurementHand Strengthbusiness.industryEpicondylitisTennis ElbowEquipment DesignGeneral MedicineMiddle Agedmedicine.diseaseSurgeryTreatment Outcomemedicine.anatomical_structureTennisChronic DiseaseOrthopedic surgeryPhysical therapyGolfUpper limbFemaleSurgerybusinessRange of motionFollow-Up StudiesArchives of Orthopaedic and Trauma Surgery
researchProduct

ACUTE VISION LOSS AS THE ONLY SIGN OF LEUKEMIA RELAPSE.

2016

Purpose To report a case of unilateral exudative retinal detachment as the sole presentation of relapsing B-type lymphoblastic leukemia in a 35-year-old man after 3 years of remission. Methods Case report. Results A 35-year-old man in complete remission of high-risk type B acute lymphoblastic leukemia (ALL-B) presented with acute vision loss in his left eye. Exudative retinal detachment was diagnosed at initial evaluation. Hematological and ocular studies were performed. Although there was no evidence of blood, cerebrospinal fluid, or bone marrow disease relapse, transvitreal retinochoroidal cytology identified the infiltration of lymphoblastic leukemic B cells with t(12:21) translocation a…

AdultMalemedicine.medical_specialtyVisual acuitymedicine.medical_treatmentBiopsyVisual AcuityVitrectomyAntineoplastic AgentsEndotamponadeBlindnessGastroenterology03 medical and health sciences0302 clinical medicineCerebrospinal fluidRecurrencehemic and lymphatic diseasesInternal medicineCytologyPrecursor B-Cell Lymphoblastic Leukemia-LymphomaVitrectomyBiopsymedicineHumansSilicone OilsB Acute Lymphoblastic Leukemiamedicine.diagnostic_testbusiness.industryRetinal DetachmentMagnetic resonance imagingGeneral MedicineExudative retinal detachmentFlow CytometryMagnetic Resonance ImagingOphthalmology030220 oncology & carcinogenesisAcute Disease030221 ophthalmology & optometrymedicine.symptomInjections IntraocularbusinessRetinal casesbrief reports
researchProduct

Comparative neurocognitive effects of lithium and anticonvulsants in long-term stable bipolar patients

2015

Background: The aim of choosing a mood-stabilizing drug (lithium or anticonvulsants) or a combination of them with minimal neurocognitive effects is to stimulate the development of criteria for a therapeutic adequacy, particularly in Bipolar Disorder (BD) patients who are clinically stabilized. Method: Three groups of BD patients were established according to their treatment: (i) lithium monotherapy (n=29); (ii) lithium together with one or more anticonvulsants (n=28); and (iii) one or more anticonvulsants (n=16). A group of healthy controls served as the control (n=25). The following tests were applied: Wechsler Adult Intelligence Scale, Trail Making Test, Wechsler Memory Scale, Rey Comple…

AdultMalemedicine.medical_specialtyWechsler Memory ScaleBipolar DisorderTrail Making TestNeuropsychological TestsAudiologyExecutive FunctionYoung Adult03 medical and health sciences0302 clinical medicineVisual memoryWisconsin Card Sorting TestAntimanic AgentsmedicineHumansAttentionWorking memoryWechsler Adult Intelligence ScaleMiddle AgedExecutive functions030227 psychiatryPsychiatry and Mental healthClinical PsychologyMemory Short-TermLithium CompoundsAnticonvulsantsDrug Therapy CombinationFemaleCognition DisordersPsychologyNeurocognitive030217 neurology & neurosurgeryClinical psychologyJournal of Affective Disorders
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Degree of Postictal Suppression Depends on Seizure Induction Time in Magnetic Seizure Therapy and Electroconvulsive Therapy.

2017

OBJECTIVES Anesthesia is required for both magnetic seizure therapy (MST) and electroconvulsive therapy (ECT), although it has anticonvulsant properties. In this case, bispectral index (BIS) monitoring, a specific electroencephalogram-derived monitoring, can be used to find the optimal seizure induction time during anesthesia to elicit adequate seizures. A measurement of seizure adequacy in electroencephalogram is the postictal suppression. The purpose of this study was to investigate the influence of seizure induction time on the degree of postictal suppression by comparing BIS versus no-BIS monitoring in MST and ECT. METHODS Twenty patients with treatment-resistant depression were randoml…

AdultMalemedicine.medical_treatmentNeuroscience (miscellaneous)law.invention03 medical and health sciencesDepressive Disorder Treatment-Resistant0302 clinical medicineElectroconvulsive therapyConsciousness MonitorsElectromagnetic FieldsRandomized controlled triallawPredictive Value of TestsSeizuresmedicineHumansAnesthesiaProspective StudiesElectroconvulsive TherapyAgedPsychiatric Status Rating ScalesCross-Over Studiesbusiness.industryElectroencephalographyMiddle AgedCrossover study030227 psychiatryPsychiatry and Mental healthAnticonvulsantTreatment OutcomeMagnetic seizure therapyBispectral indexAnesthesiaBrain stimulationFemaleAnalysis of variancebusinesshuman activities030217 neurology & neurosurgeryThe journal of ECT
researchProduct

Complications of Poly Implant Prothèse breast implants: the current discussion

2013

Against the background of the current discussion about Poly Implant Prothèse (PIP, Seyne-sur-mer, France) breast implants, we want to present a case demonstrating the complications such as implant rupture, silicone dissemination and level III silicone lymphadenopathy. A 29-year-old woman with cosmetic breast augmentation with PIP implants 5 years previously showed a sensitive swelling in her right axilla and neck region. All tests to detect an infectious or lymphomatous lymphadenopathy were negative. After ultrasound and MRI, rupture of the right implant was assumed and multiple pathologically enlarged lymph nodes up to supraclavicular region were shown. An excision biopsy of one axillary l…

AdultReoperationmedicine.medical_specialtyAxillary lymph nodesBiopsyBreast ImplantsBiomedical EngineeringProsthesis DesignSilicone Gelschemistry.chemical_compoundSiliconeBiopsymedicineHumansBreast ImplantationLymphatic DiseasesBreast augmentationLymph nodeDevice Removalmedicine.diagnostic_testbusiness.industryForeign-Body ReactionGeneral MedicineProsthesis FailureSurgeryAxillaTreatment Outcomemedicine.anatomical_structurechemistryAxillaLymph Node ExcisionFemaleSurgeryLymph NodesLymphImplantbusinessExpert Review of Medical Devices
researchProduct