Search results for "IH"

showing 10 items of 9382 documents

Positron Annihilation Lifetime Spectroscopy Insight on Free Volume Conversion of Nanostructured MgAl2O4 Ceramics

2021

H.K. and A.I.P. are grateful for the support from the COST Action CA17126. H.K. was also supported by the Ministry of Education and Science of Ukraine (project for young researchers No. 0119U100435). In addition, I.K. and H.K. were also supported by the National Research Foundation of Ukraine via project 2020.02/0217, while the research of A.I.P. was funded by the Latvian research council via the Latvian National Research Program under the topic ?High-Energy Physics and Accelerator Technologies?, Agreement No: VPP-IZM-CERN-2020/1-0002. In addition, the research of A.I.P. has been supported by the Latvian-Ukrainian Grant LV-UA/2021/5. The Institute of Solid State Physics, University of Latvi…

010302 applied physicsPositron trappingGeneral Chemical EngineeringFree-volume defectsPositron annihilationpositron annihilationnanoporespositronium decay02 engineering and technologynanostructured ceramicsfree-volume defectsnanostructured ceramics; positron annihilation; positronium decay; positron trapping; free-volume defects; nanopores021001 nanoscience & nanotechnologyPositronium decay7. Clean energy01 natural sciencesNanoporesChemistry0103 physical sciences:NATURAL SCIENCES [Research Subject Categories]positron trappingGeneral Materials Science0210 nano-technologyNanostructured ceramicsQD1-999Nanomaterials
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Positron trapping defects in free-volume investigation of Ge–Ga–S–CsCl glasses

2016

Abstract Evolution of free-volume positron trapping defects caused by crystallization process in (80GeS 2 –20Ga 2 S 3 ) 100−х (СsCl) x , 0 ≤ x ≤ 15 chalcogenide-chalcohalide glasses was studied by positron annihilation lifetime technique. It is established that CsCl additives in Ge–Ga–S glassy matrix transform defect-related component spectra, indicating that the agglomeration of free-volume voids occurs in initial and crystallized (80GeS 2 –20Ga 2 S 3 ) 100−х (СsCl) x , 0 ≤ x ≤ 10 glasses. Void fragmentation in (80GeS 2 –20Ga 2 S 3 ) 85 (СsCl) 15 glass can be associated with loosing of their inner structure. Full crystallization in each of these glasses corresponds to the formation of defe…

010302 applied physicsVoid (astronomy)RadiationMaterials scienceAnalytical chemistryChalcogenide glassMineralogy02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesPositron trappingSpectral linelaw.inventionAbsorption edgeFragmentation (mass spectrometry)law0103 physical sciencesCrystallization0210 nano-technologyInstrumentationPositron annihilationRadiation Measurements
researchProduct

The role of radio frequency scattering in high-energy electron losses from minimum-B ECR ion source

2021

Abstract The measurement of the axially lost electron energy distribution escaping from a minimum-B electron cyclotron resonance ion source in the range of 4–800 keV is reported. The experiments have revealed the existence of a hump at 150–300 keV energy, containing up to 15% of the lost electrons and carrying up to 30% of the measured energy losses. The mean energy of the hump is independent of the microwave power, frequency and neutral gas pressure but increases with the magnetic field strength, most importantly with the value of the minimum-B field. Experiments in pulsed operation mode have indicated the presence of the hump only when microwave power is applied, confirming that the origi…

010302 applied physics[PHYS]Physics [physics]High energyMaterials scienceScatteringAstrophysics::High Energy Astrophysical Phenomena[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]scatteringElectronhiukkaskiihdyttimetCondensed Matter Physicselektronit01 natural sciences7. Clean energyIon source010305 fluids & plasmasNuclear Energy and Engineering0103 physical sciencessirontaRadio frequencyAtomic physics
researchProduct

The biased disc of an electron cyclotron resonance ion source as a probe of instability-induced electron and ion losses

2019

International audience; Electron Cyclotron Resonance Ion Source (ECRIS) plasmas are prone to kinetic instabilities resulting in loss of electron and ion confinement. It is demonstrated that the biased disk of an ECRIS can be used as a probe to quantify such instability-induced electron and ion losses occurring in less than 10 µs. The qualitative interpretation of the data is supported by the measurement of the energy spread of the extracted ion beams implying a transient plasma potential >1.5 kV during the instability. A parametric study of the electron losses combined with electron tracking simulations allows for estimating the fraction of electrons expelled in each instability event to be…

010302 applied physics[PHYS]Physics [physics]Materials sciencesyklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]ElectronPlasmahiukkaskiihdyttimetKinetic energyplasmafysiikka01 natural sciencesInstabilityElectron cyclotron resonanceIon source010305 fluids & plasmasIonPhysics::Plasma Physics0103 physical sciencesTransient (oscillation)Atomic physicsInstrumentation
researchProduct

Heavy enzymes and the rational redesign of protein catalysts

2019

Abstract An unsolved mystery in biology concerns the link between enzyme catalysis and protein motions. Comparison between isotopically labelled “heavy” dihydrofolate reductases and their natural‐abundance counterparts has suggested that the coupling of protein motions to the chemistry of the catalysed reaction is minimised in the case of hydride transfer. In alcohol dehydrogenases, unnatural, bulky substrates that induce additional electrostatic rearrangements of the active site enhance coupled motions. This finding could provide a new route to engineering enzymes with altered substrate specificity, because amino acid residues responsible for dynamic coupling with a given substrate present…

010402 general chemistryProtein Engineering01 natural sciencesBiochemistryCatalysisEnzyme catalysisisotope effectsCatalytic DomainDihydrofolate reductaseMolecular BiologyAlcohol dehydrogenasechemistry.chemical_classificationalcohol dehydrogenasesCarbon Isotopesdihydrofolate reductasesbiologyBacteriaNitrogen Isotopes010405 organic chemistryConceptOrganic ChemistryAlcohol DehydrogenaseActive siteSubstrate (chemistry)Protein engineeringDeuteriumCombinatorial chemistrymolecular dynamics0104 chemical sciencesKineticsTetrahydrofolate Dehydrogenaseenzyme engineeringEnzymechemistrybiology.proteinBiocatalysisMolecular MedicineConcepts
researchProduct

Computational study of the spin-forbidden H 2 oxidative addition to 16-electron Fe(0) complexes

2003

International audience; The spin-forbidden oxidative addition of H2 to Fe(CO)4, Fe(PH3)4, Fe(dpe)2 and Fe(dmpe)2 [dpe = H2PCH2CH2PH2, dmpe = (CH3)2PCH2CH2P(CH3)2] has been investigated by density functional theory using a modified B3PW91 functional. All 16-electron fragments are found to adopt a spin triplet ground state. The H2 addition involves a spin crossover in the reagents region of configurational space, at a significantly higher energy relative to the triplet dissociation asymptote and, for the case of Fe(CO)4·H2, even higher than the singlet dissociation asymptote. After crossing to the singlet surface, the addition proceeds directly to the classical cis-dihydride product. Only for…

010405 organic chemistryChemistry010402 general chemistryPhotochemistry01 natural sciencesOxidative additionDissociation (chemistry)0104 chemical sciencesInorganic Chemistry[CHIM.THEO]Chemical Sciences/Theoretical and/or physical chemistrySpin crossoverMoleculePhysical chemistryDensity functional theory[CHIM.COOR]Chemical Sciences/Coordination chemistrySinglet stateDihydrogen complexGround state
researchProduct

A green and efficient method for the synthesis of homodimeric (β-dicarbonyl) arylmethanes and dihydropyridine from dimedone in water

2018

A direct method has been developed for the synthesis of the dihydropyridine ring system by means of Michael reaction. The reaction of dimedone with 1 .0 equiv. of amines in water provides intermediate product, which allowed dihydropyridine derivatives by intramolecular cyclization in various yields. Of particular interest is the use of the water as solvent of reaction and in absence of catalyst. Also these operating conditions protect the environment and economic points of view.Keywords: aqueous synthesis; bioactivity; dihydropyridine; dimedone; green method; selective conditions

010405 organic chemistryChemistryDihydropyridine010402 general chemistry01 natural sciencesaqueous synthesis; bioactivity; dihydropyridine; dimedone; green method; selective conditionsIntermediate product0104 chemical sciencesCatalysisSolventchemistry.chemical_compoundDimedoneIntramolecular forcemedicineMichael reactionOrganic chemistryDihydropyridine derivativesmedicine.drugJournal of Fundamental and Applied Sciences
researchProduct

2017

The title compound, C12H9BrN2O3, was prepared in two steps from 2-chloro-3-nitropyridine. The nitrobiaryl unit is twisted, with dihedral angles of 35.4 (5)° between the nitro substituent and the pyridine ring to which it is bound, and 51.0 (5)° between the nitro group and the benzene ring. In the crystal, the molecules are connectedviaC—H...O hydrogen bonds, forming strands along theb-axis direction.

010405 organic chemistryHydrogen bondSubstituentCrystal structureDihedral angle010403 inorganic & nuclear chemistryRing (chemistry)01 natural sciences0104 chemical sciencesCrystallographychemistry.chemical_compoundchemistryPyridineNitroBenzeneIUCrData
researchProduct

Chronospeciation of uranium released in soil during a long-term DU shell weathering experiment.

2021

Corrosion process was investigated of depleted uranium (DU) ammunition fragments buried for three years in aerobic soils continuously irrigated with water. The continuing corrosion process was triggered through formation of soluble uranyl oxyhydrate phases such as metaschoepite and becquerelite, which were identified by micro-Raman and X-ray diffraction spectroscopy. The soil was not amended by phosphates and, therefore, no uranyl phosphates were found as corrosion products on the DU surfaces by X-ray photoelectron spectroscopy. A speciation modelling at high temporal sequence (chronospeciation approach) indicated that the abundant Fe oxyhydroxides in the soil immobilized the U(IV) released…

010504 meteorology & atmospheric sciencesHealth Toxicology and Mutagenesischemistry.chemical_elementWeathering010501 environmental sciences01 natural sciencesCorrosionFerrihydritechemistry.chemical_compoundPore water pressureSoilRadiation MonitoringEnvironmental ChemistrySoil Pollutants RadioactiveWaste Management and Disposal0105 earth and related environmental sciencesTotal organic carbonGeneral MedicineUraniumUranylPollutionCorrosionchemistryEnvironmental chemistrySoil waterUraniumJournal of environmental radioactivity
researchProduct