Search results for "INSTRUMENT"

showing 10 items of 5652 documents

Conic optical fiber probe for generation and characterization of microbubbles in liquids

2021

Abstract A novel optical fiber probe has been developed to provide mechanical stability to microbubbles generated in fluids, the tip of the fiber is etched with hydrofluoric acid to pierce a truncated horn that fastens the microbubbles to the fiber tip and prevents misalignment or detachment caused by convection currents, vibrations or shocks in the liquid. Microbubbles are photo-thermally generated on the etched fiber and used as Fabry-Perot cavity sensor. Two methods were used to interrogate the probe: the first one, in the wavelength domain, is suitable for calibration in static or quasi static situations; the second one, in the time domain, can be used in dynamic environments. Experimen…

010302 applied physicsConvectionMaterials sciencebusiness.industryMetals and Alloys02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsWavelengthOptics0103 physical sciencesMicrobubblesCalibrationFiberTime domainElectrical and Electronic Engineering0210 nano-technologybusinessInstrumentationQuasistatic processBar (unit)Sensors and Actuators A: Physical
researchProduct

Determining the deformation and resulting coupling efficiency degradation of ultrastable fiber-coupled optical benches under load.

2020

Fiber-coupled optical benches are an integral part of many laser systems. The base of such an optical bench is usually a slab of solid material, onto which optical components are fixed. In many environments, the ability to retain high fiber coupling efficiency under mechanical loads is essential. In this article, we study the fiber-to-fiber coupling efficiency under the application of static mechanical loads experimentally and theoretically: We constructed a simple three-point bending setup to interferometrically measure the deformation of an optical bench under load. Using the same setup, we further recorded the resulting coupling efficiency variations. The examined optical benches are bas…

010302 applied physicsCouplingMaterials scienceAcousticsPhysics::OpticsZerodurBendingDeformation (meteorology)Laser01 natural sciencesFinite element method010305 fluids & plasmaslaw.inventionlaw0103 physical sciencesSlabInstrumentationBeam (structure)The Review of scientific instruments
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Low energy nano diffraction (LEND) – A versatile diffraction technique in SEM

2019

Abstract Electron diffraction is a powerful characterization method that is used across different fields and in different instruments. In particular, the power of transmission electron microscopy (TEM) largely relies on the capability to switch between imaging and diffraction mode enabling identification of crystalline phases and in-depth studies of crystal defects, to name only examples. In contrast, while diffraction techniques have found their way into the realm of scanning electron microscopy (SEM) in the form of electron backscatter diffraction and related techniques, on-axis transmission diffraction is still in its infancy. Here we present a simple but versatile setup that enables a ‘…

010302 applied physicsDiffractionMaterials scienceGrapheneScanning electron microscopebusiness.industry02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesCrystallographic defectAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionCharacterization (materials science)Electron diffractionlawTransmission electron microscopy0103 physical sciencesOptoelectronics0210 nano-technologybusinessInstrumentationElectron backscatter diffractionUltramicroscopy
researchProduct

Fast-ADT: A fast and automated electron diffraction tomography setup for structure determination and refinement.

2020

Abstract Electron crystallography has focused in the last few years on the analyses of microcrystals, mainly organic compounds, triggered by recent publications on acquisition methods based on direct detection cameras and continuous stage tilting. However, the main capability of a transmission electron microscope is the access to features at the nanometre scale. In this context, a new acquisition method, called fast and automated diffraction tomography (Fast-ADT), has been developed in form of a general application in order to get the most of the diffraction space from a TEM. It consists of two subsequent tilt scans of the goniometric stage; one to obtain a crystal tracking file and a secon…

010302 applied physicsDiffractionMaterials scienceMicroscopeElectron crystallographybusiness.industryContext (language use)02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionDiffraction tomographyOpticsElectron diffractionlawGoniometer0103 physical sciences0210 nano-technologybusinessInstrumentationPowder diffractionUltramicroscopy
researchProduct

Quasi-parallel precession diffraction: Alignment method for scanning transmission electron microscopes.

2018

Abstract A general method to set illuminating conditions for selectable beam convergence and probe size is presented in this work for Transmission Electron Microscopes (TEM) fitted with µs/pixel fast beam scanning control, (S)TEM, and an annular dark field detector. The case of interest of beam convergence and probe size, which enables diffraction pattern indexation, is then used as a starting point in this work to add 100 Hz precession to the beam while imaging the specimen at a fast rate and keeping the projector system in diffraction mode. The described systematic alignment method for the adjustment of beam precession on the specimen plane while scanning at fast rates is mainly based on …

010302 applied physicsDiffractionMaterials sciencebusiness.industryDetector02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesDark field microscopyAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionOpticsElectron diffractionProjectorlaw0103 physical sciencesPrecessionElectron microscope0210 nano-technologybusinessInstrumentationBeam (structure)Ultramicroscopy
researchProduct

Analog isolated electronic dynamometer based on a magnetoresistive current sensor.

2017

In this work, an electronic system is presented to measure the force applied by a solenoid. The originality of the work is focused on the use of a magnetoresistive current sensor to provide the isolation barrier needed in the actual industrial plant where the solenoids are working. The design of the electronic system is presented as well as experimental measurements as a result of a calibration process showing a negligible hysteresis with that specific sensor. The magnetoresistive current sensor is used to develop transmission functions rather than playing its usual sensing roles.

010302 applied physicsDynamometerMagnetoresistancebusiness.industryComputer science010401 analytical chemistryElectrical engineeringProcess (computing)Solenoid01 natural sciences0104 chemical sciencesHysteresisNuclear magnetic resonanceTransmission (telecommunications)0103 physical sciencesCalibrationCurrent sensorbusinessInstrumentationThe Review of scientific instruments
researchProduct

RBS and ERD cross-sections and optical model parameters for the analysis of lithium, boron and nickel

2000

Abstract Elastic scattering cross-sections for RBS analysis of nickel by 7 Li and 11 B ion backscattering near the Coulomb barrier have been determined. The lithium ion measurements were performed in the energy range of 8–15 MeV at the laboratory angles of 115° and 135°. For boron ions the energies between 14 and 24 MeV and scattering angles of 89°, 110° and 130° were used. For the analysis of lithium and boron by ERD the scattering cross-sections have been calculated by kinematically reversing the backscattering process. The calculated 58 Ni ion energies thus varied between 65 and 125 MeV for lithium and between 75 and 130 MeV for boron recoils. For the Li + Ni and B + Ni systems the thres…

010302 applied physicsElastic scatteringNuclear and High Energy PhysicsScatteringchemistry.chemical_elementCoulomb barrier02 engineering and technology021001 nanoscience & nanotechnology7. Clean energy01 natural sciencesIonNickelsymbols.namesakechemistry0103 physical sciencessymbolsLithiumRutherford scatteringAtomic physics0210 nano-technologyBoronInstrumentationNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Design and experimental validation of a magnetic device for stem cell culture.

2020

Cell culture of bone and tendon tissues requires mechanical stimulation of the cells in order to mimic their physiological state. In the present work, a device has been conceived and developed to generate a controlled magnetic field with a homogeneous gradient in the working space. The design requirement was to maximize the magnetic flux gradient, assuring a minimum magnetizing value in a 15 mm × 15 mm working area, which highly increases the normal operating range of this sort of devices. The objective is to use the machine for two types of biological tests: magnetic irradiation of biological samples and force generation on paramagnetic particles embedded in scaffolds for cell culture. The…

010302 applied physicsElectromagnetic fieldMaterials scienceStem CellsCell Culture TechniquesExperimental validationEquipment Designequipment and supplies01 natural sciencesMagnetic flux010305 fluids & plasmasMagnetic fieldMagnetic FieldsCell cultureDental pulp stem cells0103 physical sciencesMagnetic nanoparticlesIrradiationInstrumentationhuman activitiesBiomedical engineeringThe Review of scientific instruments
researchProduct

Formation of dislocations and hardening of LiF under high-dose irradiation with 5–21 MeV 12C ions

2017

R. Zabels, I. Manika, J. Maniks, and R.Grants acknowledge the national project IMIS2, and A. Dauletbekova, M. Baizhumanov, and M. Zdorovets the Ministry of Education and Science of the Republic of Kazakhstan for the financial support.

010302 applied physicsEnergy lossMaterials sciencePhysics::Instrumentation and DetectorsAtomic force microscopyAstrophysics::High Energy Astrophysical PhenomenaPhysics::Medical Physicsmacromolecular substances02 engineering and technologyGeneral ChemistryNanoindentation021001 nanoscience & nanotechnology01 natural sciencesMolecular physicsIsotropic etchingElastic collisionIonPhysics::Plasma Physics0103 physical sciences:NATURAL SCIENCES:Physics [Research Subject Categories]Hardening (metallurgy)General Materials ScienceIrradiationAtomic physics0210 nano-technologyApplied Physics A
researchProduct