Search results for "Kyberturvallisuus"

showing 10 items of 117 documents

Detection of distributed denial-of-service attacks in encrypted network traffic

2016

Tausta: Hajautetut palvelunestohyökkäykset ovat jo kaksi vuosikymmentä vanhoja. Useita strategioita on kehitetty taistelemaan niiden kasvavaa määrää vastaan vuosien varrella. Sovelluskerroksen protokollien hyökkäykset yleistyvät, ja niitä on hankalampi havaita. Nykyiset havainnointimenetelmät analysoivat tietoliikenteen piirteitä. Paketin sisältö on salattua SSL/TLS liikenteessä, josta syystä sitä ei voida analysoida. Tavoitteet: Tutkielma tarkastelee salatun liikenteen palvelunestohyökkäysten havaintometodien nykyistä tilaa. Tutkielma esittelee myös klusterointiin perustuvan menetelmän ja aikaisemman tutkimuksen kanssa vertailtavissa olevia simulaatiotuloksia. Metodit: Kirjoittaja laati ke…

salaussimulointitietoturvapalvelunestohyökkäyskyberturvallisuusverkkohyökkäykset
researchProduct

PSD2 ja sen vaikutukset verkkomaksamisen tietoturvaan ja liiketoimintamalleihin

2016

Web payments have created a whole industry around them in the last decade where sensitive data is moved around and where security is one of the key concepts. On top of internal facilities, members of the EU are regulated by EU directives of which the second will be taken to legislation by the start of year 2017. It forces the banks to open interfaces that allow third parties to use web shop customers banking credentials in order to initiate payments. Second directive on payment services brings up a set of web security hazards that have yet to be studied. In this thesis a literature review is made on web payment security. I will also study the second directive on payment services and its eff…

second directive on payment servicesverkkomaksaminencyber securitydirektiivitWeb-paymenttietoturvapayment service providerkyberturvallisuusdirective on payment services
researchProduct

Leveraging National Auditing Criteria to Implement Cybersecurity Safeguards for the Automotive Emergency Response Vehicles : A case study from Finland

2017

A modern Emergency Response Vehicle (ERV) is a combination of emergency services and functional mobile office on the wheels. The mobile office is aiming to leverage the benefits of fixed office while moving on the wheels. Researchers have observed that emergency response personnel including Law Enforcement Authorities (LEAs), Police and border guards, could be on the duty while having possibility to use same services compared to fixed office. On the one hand, demand of mobile office has significantly improved the emergency response services. On the other hand, emergency vehicle designers should rethink the demand of users. This resulted into modern standard emergency response vehicle with t…

secure technologyinformation securitysafeguardcross-border collaborationKATAKRItietoturvakyberturvallisuusturvallisuustekniikkaemergency response vehiclesyhteistyö
researchProduct

Emerging Cyber risk Challenges in Maritime Transportation

2022

Maritime security and surveillance have become one of the main areas in managing overall situational awareness. For example, the growing importance of maritime traffic in cross-border trade has created new pressures to develop new technologies for accident prevention, especially in the ports. Maritime safety is also a matter of concern for continuity management. Automatic ship alarm systems, coastal radars and coastal cameras are not alone sufficient equipment to build maritime awareness. The Universal Shipborne Automatic Identification System (AIS) is a ship transponder system that is a globally used tracking system, but highly vulnerable to hacking. A major maritime traffic problem arises…

situational awarenesscybersecuritymeriliikenneinformation sharingsatamatport systemskyberturvallisuustilannekuvarisksriskitInternational Conference on Cyber Warfare and Security
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

A Novel Model for Cybersecurity Economics and Analysis

2017

In recent times, major cybersecurity breaches and cyber fraud had huge negative impact on victim organisations. The biggest impact made on major areas of business activities. Majority of organisations facing cybersecurity adversity and advanced threats suffers from huge financial and reputation loss. The current security technologies, policies and processes are providing necessary capabilities and cybersecurity mechanism to solve cyber threats and risks. However, current solutions are not providing required mechanism for decision making on impact of cybersecurity breaches and fraud. In this paper, we are reporting initial findings and proposing conceptual solution. The paper is aiming to pr…

ta113Value (ethics)Computer sciencemedia_common.quotation_subjectComputingMilieux_LEGALASPECTSOFCOMPUTING020207 software engineering02 engineering and technologyBusiness activitiesComputer securitycomputer.software_genrecybersecurity economicscyber fraudadvanced cyber threatstaloudelliset vaikutuksetcost-benefit model020204 information systemsCyber-security regulation0202 electrical engineering electronic engineering information engineeringResearch developmentkyberturvallisuuscomputercybersecurity impactReputationmedia_common2017 IEEE International Conference on Computer and Information Technology (CIT)
researchProduct

Online anomaly detection using dimensionality reduction techniques for HTTP log analysis

2015

Modern web services face an increasing number of new threats. Logs are collected from almost all web servers, and for this reason analyzing them is beneficial when trying to prevent intrusions. Intrusive behavior often differs from the normal web traffic. This paper proposes a framework to find abnormal behavior from these logs. We compare random projection, principal component analysis and diffusion map for anomaly detection. In addition, the framework has online capabilities. The first two methods have intuitive extensions while diffusion map uses the Nyström extension. This fast out-of-sample extension enables real-time analysis of web server traffic. The framework is demonstrated using …

ta113Web serverComputer Networks and Communicationsbusiness.industryComputer scienceRandom projectionDimensionality reductionRandom projectionPrincipal component analysisIntrusion detection systemAnomaly detectionMachine learningcomputer.software_genreCyber securityWeb trafficPrincipal component analysisDiffusion mapAnomaly detectionIntrusion detectionArtificial intelligenceData miningWeb servicebusinesskyberturvallisuuscomputer
researchProduct

Health care and cyber threats

2019

ta113critical infrastructurecyber threatkyberuhkaterveydenhuoltocyber securitykyberturvallisuushealth carekriittinen infrastruktuuriFinnish Journal of eHealth and eWelfare
researchProduct

Towards the cyber security paradigm of ehealth: Resilience and design aspects

2017

Digital technologies have significantly changed the role of healthcare clients in seeking and receiving medical help, as well as brought up more cooperative policy issues in healthcare cross-border services. Citizens continue to take a more co-creative role in decisions about their own healthcare, and new technologies can enable and facilitate this emergent trend. In this study, healthcare services have been intended as a critical societal sector and therefore healthcare systems are focused on as critical infrastructures that ought to be protected from all types of fears, including cyber security threats and attacks. Despite continual progress in the systemic risk management of cyber domain…

ta113e-healthcareEmerging technologiesbusiness.industrycyber securityComputer securitycomputer.software_genreAnticipation (artificial intelligence)Critical information infrastructureHealth careSystemic riskeHealthBusinessteleterveydenhuoltoResilience (network)kyberturvallisuuscomputerHealthcare system
researchProduct

Creating modern blue pills and red pills

2019

The blue pill is a malicious stealthy hypervisor-based rootkit. The red pill is a software package that is designed to detect such blue pills. Since the blue pill was originally proposed there has been an ongoing arms race between developers that try to develop stealthy hypervisors and developers that try to detect such stealthy hypervisors. Furthermore, hardware advances have made several stealth attempts impossible while other advances enable even more stealthy operation. In this paper we describe the current status of detecting stealth hypervisors and methods to counter them. peerReviewed

tekninen rikostutkintaforensicsvirtualisointikyberrikollisuusinformation securitytietoturvakyberturvallisuusvirtualizationtietomurtoverkkohyökkäykset
researchProduct