Search results for "Left ventricular dysfunction"

showing 2 items of 12 documents

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Epidemiology and pathophysiology of left ventricular abnormalities in chronic kidney disease: a review.

2010

Introduction Cardiovascular diseases are highly prevalent in patients with chronic kidney disease (CKD), and represent the major hazard for mortality in this population. Anomalies of left ventricular (LV) structure and function are very frequent too among CKD patients, and show a negative impact on cardiovascular prognosis. Methods We searched PubMed for manuscripts regarding left ventricular hypertrophy (LVH) in CKD. Definition of LVH was different according to different studies. Results In patients with end-stage renal disease, the prevalence of LVH is higher than 70%. Studies in patients with less advanced CKD have reported increasing prevalence of LVH along with declining renal function…

medicine.medical_specialtyAnemiaPopulationDiastoleRenal functionDiseaseurologic and male genital diseasesLeft ventricular hypertrophyKidneyRisk AssessmentVentricular Function LeftVentricular Dysfunction LeftRisk FactorsInternal medicinemedicinePrevalenceHumanscardiovascular diseasesIntensive care medicineeducationeducation.field_of_studyLeft ventricular dysfunctionbusiness.industryLeft ventricular hypertrophymedicine.diseaseChronic kidney disease.NephrologyHeart failureChronic DiseaseCardiologyDisease ProgressionKidney Failure ChronicHypertrophy Left VentricularKidney DiseasesbusinessKidney diseaseGlomerular Filtration RateJournal of nephrology
researchProduct