Search results for "Lip"

showing 10 items of 8306 documents

Monophosphoryl lipid A coating of hydroxyethyl starch nanocapsules drastically increases uptake and maturation by dendritic cells while minimizing th…

2015

Enhancing delivery of antigens to dendritic cells (DCs) is essential for the induction of vigorous antigen-specific cellular immune responses. Aim of the present study was to evaluate the properties of hydroxyethyl starch nanocapsules (HES-NCs) functionalized with anti-CD40, anti-DEC205, interferon-γ (IFNγ) and/or monophosphoryl lipid A (MPLA) with respect to the overall uptake, the released cytokine profile, and the influence on phenotypic maturation of human monocyte-derived DCs using flow cytometry, confocal microscopy and enzyme-linked immunosorbent assays. NC uptake by DCs was significantly enhanced by functionalizing NCs with anti-CD40 or MPLA. With respect to the cytokine profile and…

medicine.medical_treatmentMonophosphoryl Lipid ANanocapsulesFlow cytometryHydroxyethyl Starch DerivativesImmune systemAntigenAdjuvants ImmunologicNanocapsulesInterferonmedicineHumansCells CulturedMicroscopy ConfocalGeneral VeterinaryGeneral Immunology and Microbiologymedicine.diagnostic_testChemistryPublic Health Environmental and Occupational HealthDendritic CellsTh1 CellsInterleukin-12Cell biologyToll-Like Receptor 4Infectious DiseasesLipid ANanomedicineBiochemistryMolecular MedicineAdjuvantCD80medicine.drugVaccine
researchProduct

Analysis of a soluble lipid-protein complex carrying endogenous 11-cis retinaldehyde from bovine retinal pigment epithelium.

1989

A soluble lipid-protein complex in bovine retinal pigment epithelium is shown to carry endogenous 11-cis retinaldehyde, in the extent of 15% of the total 11-cis retinaldehyde found in this tissue. The complex, analyzed with respect to its chemical composition, exhibits a lipid composition close resembling the lipid composition of the rod outer segment membrane; the SDS-PAGE evidences the presence of a number of protein bands, two of which of 34 and 27 kDa appear glycoproteins. Finally, the lipid-protein complex exhibits a discrete level of a Cathepsin D-like protease activity. From the above, the possibility is discussed that the soluble lipid-protein complex could represent some phagolysos…

medicine.medical_treatmentPhagocytosisLipoproteinsClinical BiochemistryEndogenyBiologyPigmentRetinoidsCytosolmedicineAnimalsPigment Epithelium of EyeMolecular BiologyPhospholipidsTriglycerideschemistry.chemical_classificationCathepsinProteaseRetinal pigment epitheliumCell BiologyGeneral MedicineMolecular Weightmedicine.anatomical_structureCholesterolchemistryBiochemistryvisual_artRetinaldehydevisual_art.visual_art_mediumChromatography GelRetinaldehydeCattleElectrophoresis Polyacrylamide GelGlycoproteinCarrier ProteinsMolecular and cellular biochemistry
researchProduct

A pyrroloquinazoline derivative with anti-inflammatory and analgesic activity by dual inhibition of cyclo-oxygenase-2 and 5-lipoxygenase

2002

Abstract In a previous study, we reported a new pyrroloquinazoline derivative, 3-(4′-acetoxy-3′,5′-dimethoxy)benzylidene-1,2-dihydropyrrolo[2,1- b ]quinazoline-9-one (PQ), which inhibited human purified 5-lipoxygenase activity and prostaglandin E 2 release in lipopolysaccharide-stimulated RAW 264.7 cells. In the present work, we show that PQ inhibits cyclo-oxygenase-2 activity in intact cell assays (human monocytes) and purified enzyme preparations (ovine isoenzymes) without affecting cyclo-oxygenase-1 activity. This behaviour was confirmed in vivo by using the zymosan-injected mouse air pouch model, where PQ caused a marked reduction in cell migration and leukotriene B 4 levels at 4 h, as …

medicine.medical_treatmentPharmacologyMonocytesMicechemistry.chemical_compoundIn vivomedicineAnimalsEdemaHumansCyclooxygenase InhibitorsPyrrolesLipoxygenase InhibitorsEnzyme InhibitorsProstaglandin E2Pain MeasurementPharmacologyAnalgesicsArachidonate 5-LipoxygenaseSheepCyclooxygenase 2 InhibitorsDose-Response Relationship DrugbiologyChemistryAnti-Inflammatory Agents Non-SteroidalZymosanMembrane ProteinsBiological activityIsoenzymesBiochemistryMechanism of actionCyclooxygenase 2Prostaglandin-Endoperoxide SynthasesEnzyme inhibitorArachidonate 5-lipoxygenaseQuinazolinesQuinolinesbiology.proteinFemalemedicine.symptomProstaglandin Emedicine.drug
researchProduct

Review of Pharmacokinetics and Pharmacogenetics in Atypical Long-Acting Injectable Antipsychotics

2021

Over the last two decades, pharmacogenetics and pharmacokinetics have been increasingly used in clinical practice in Psychiatry due to the high variability regarding response and side effects of antipsychotic drugs. Specifically, long-acting injectable (LAI) antipsychotics have different pharmacokinetic profile than oral formulations due to their sustained release characteristics. In addition, most of these drugs are metabolized by CYP2D6, whose interindividual genetic variability results in different metabolizer status and, consequently, into different plasma concentrations of the drugs. In this context, there is consistent evidence which supports the use of therapeutic drug monitoring (TD…

medicine.medical_treatmentPopulationAripiprazolePharmaceutical ScienceContext (language use)ReviewPharmacology030226 pharmacology & pharmacy03 medical and health sciences0302 clinical medicinearipiprazolePharmacy and materia medicamedicineAntipsychoticsPaliperidoneeducationAntipsychoticPopulation pharmacokinetic modelspharmacogeneticseducation.field_of_studyRisperidonerisperidonemedicine.diagnostic_testbusiness.industryCYP2D6PaliperidoneRisperidoneLAIRS1-441antipsychoticsTherapeutic drug monitoringpopulation pharmacokinetic modelsPharmacogeneticsAripiprazolebusinesspaliperidone030217 neurology & neurosurgeryPharmacogeneticsmedicine.drug
researchProduct

Lihavuuden biopoliittinen haltuunotto : Suomen Lääkärilehden tekstit lihavuudesta vuosilta 1995-2008 medikalisoituneessa kulttuurissa

2009

Tutkielmassa käsitellään Suomen Lääkärilehden (n=47) kirjoittelua lihavuudesta ja ylipainosta vuosien 1995-2008 väliseltä ajalta. Varsinainen tutkimustehtävä on kahtalainen: tutkimuksessa keskitytään siihen millaisia hegemonisia diskursseja terveysalan asiantuntijat tuottavat Suomen Lääkärilehden lihavuuspuheessa. Toisekseen tarkastellaan, miten esiin nostetuilla hegemonisilla diskursseilla pyritään kontrolloimaan ihmisten elämänkäytäntöjä. Huomio kohdistuu erityisesti lihavuuden ja ruumiillisuuksien hallinnan käytäntöihin, joilla terveysammattilaiset pyrkivät vaikuttamaan ihmisten tapoihin orientoitua elämäänsä. Tutkimuksen teoreettis-metodologiset ratkaisut pohjautuivat sosiaalisen konstr…

medikalisaatiolihavuusylipainoDiskurssianalyysibiopolitiikkaruumiillisuusSuomen Lääkärilehti
researchProduct

Prevalencia, búsqueda y registro clínico asistencial de pacientes con síndrome de Peutz Jeghers en Valencia

2022

El síndrome de Peutz Jeghers es una enfermedad rara de herencia autosómica dominante causada por una mutación germinal del gen STK11/LKB1, que codifica para una proteína serina/treonina/kinasa. Consiste en poliposis hamartomatosa intestinal y extraintestinal, predisposición al cáncer e hiperpigmentación mucocutánea. Se asocia a complicaciones como dolor abdominal, sangrados gastrointestinales, anemia, prolapso y ulceración de los pólipos, obstrucción e invaginación intestinal. No existe ningún tratamiento específico, solamente la adecuada instauración de protocolos. Se incluyeron pacientes que habían acudido a 10 hospitales de la provincia de Valencia, utilizando el Conjunto Mínimo de Base …

melanosispeutzUNESCO::CIENCIAS MÉDICASSTK11cáncer hereditariopoliposis:CIENCIAS MÉDICAS [UNESCO]jeghershamartomatosis
researchProduct

When Night Passes and When Day Breaks – Between the Past and the Present. Borderlines of Holocaust in Filip David’s Works

2017

Podstawowym celem tekstu jest analiza najnowszej tworczości Filipa Davida, autora nagrodzonej Nagrodą Tygodnika NIN („Nedeljne Informativne Novine") powieści Dom pamięci i zapomnienia (2014, Kuća sećanja i zabovrava). Z jednej strony twórczość serbskiego prozaika interesować nas będzie jako kontynuacja i reprezentacja współczesnego dyskursu na temat Holokaustu w Serbii. Z drugiej zaś – przyjrzymy się jego literackiej realizacji. Na przykładzie losów głównych bohaterów powieści (dzieci, które przeżyły Zagładę) pokażemy, gdzie przebiega rysowana przez autora granica istnienia Shoah w ich życiu. Na ile i w jaki sposób przeszłość wpływa na ich teraźniejszość, gdzie przebiega granica pamięci, ni…

memoryFilip DavidpamięćHolocaustliteratureliteraturatożsamośćHolokaustSerbiaidentityColloquia Humanistica
researchProduct

Tyttöjen karnevalistinen humala : tulkintoja tyttöjen alkoholikulttuurista

2001

merkityksetmielipiteetkarnevaalitalkoholinkäyttöalkoholitytötsukupuolikirjoittaminen
researchProduct

Lasten paino ei putoa ruutuaikaa vähentämällä

2022

meta-analyysiruutuaikalapset (ikäryhmät)ylipainopainoindeksifyysinen aktiivisuus
researchProduct

Anthropometric indices, lipid profile, and lipopolysaccharide-binding protein levels in metabolic endotoxemia: A case-control study in Calabar Metrop…

2020

Objectives: To determine the anthropometric indices, lipopolysaccharide-binding proteins (LBP), and lipid profile in patients with metabolic endotoxemia. Methods: The study comprised of 47 patients with metabolic endotoxemia (the metabolic endotoxemia group) and 43 controls (the control group). Patients in the metabolic endotoxemia group were categorized further into three subgroups including the normal weight group (n=8), the overweight group (n=12) and the obese group (n=27). Height, weight, waist, and hip circumference were measured, and waist-hip ratio (WHR) and body mass index (BMI) were calculated. LBP was determined by ELISA and total cholesterol, triglycerides, high density lipoprot…

metabolic endotoxemia; gut; microbiota; lipopolysaccharide-binding protein; body mass index; lipid profile; anthropometric indicesmedicine.medical_specialtyVery low-density lipoproteinWaistmedicine.diagnostic_testbusiness.industrylcsh:Medical emergencies. Critical care. Intensive care. First aidlcsh:RC86-88.9General MedicineOverweightmedicine.diseasechemistry.chemical_compoundEndocrinologyHigh-density lipoproteinchemistryInternal medicineLow-density lipoproteinmedicinelipids (amino acids peptides and proteins)medicine.symptomLipid profilebusinessBody mass indexDyslipidemiaJournal of Acute Disease
researchProduct