Search results for "MAS"

showing 10 items of 18047 documents

Mass calibration of the energy axis in ToF- E elastic recoil detection analysis

2016

We report on procedures that we have developed to mass-calibrate the energy axis of ToF-E histograms in elastic recoil detection analysis. The obtained calibration parameters allow one to transform the ToF-E histogram into a calibrated ToF-M histogram.

010302 applied physicsPhysicsNuclear and High Energy Physicsta114Physics::Instrumentation and DetectorsPhysics::Medical PhysicsAstrophysics::Instrumentation and Methods for AstrophysicsERD02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesNuclear physicsElastic recoil detectionComputer Science::Computer Vision and Pattern RecognitionHistogramelastic recoil detection analysis0103 physical sciencesCalibrationmass calibrationToF-ENuclear Experiment0210 nano-technologyInstrumentationEnergy (signal processing)Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

The effect of plasma electrode collar structure on the performance of the JYFL 14GHz electron cyclotron resonance ion source

2013

Abstract The influence of a so-called collar structure on the performance of the JYFL 14 GHz electron cyclotron resonance ion source (ECRIS) has been studied experimentally at the Department of Physics, University of Jyvaskyla (JYFL). The collar is a cylindrical structure extruding inwards from the plasma electrode. The collar length was varied between 5 and 60 mm. For some ion species a moderate performance improvement was achieved in terms of extracted beam current and transverse emittance up to 30 mm collar length. Longer collars resulted in a substantial performance decrease. Different collar materials, i.e. nonmagnetic stainless steel, aluminum and Al 2 O 3 , and a wide range of ion sp…

010302 applied physicsPhysicsNuclear and High Energy Physicsta114Plasma01 natural sciences7. Clean energyElectron cyclotron resonanceIon source010305 fluids & plasmasCollarIon0103 physical sciencesElectrodeThermal emittanceddc:530Atomic physicsInstrumentationBeam (structure)
researchProduct

System for control of polarization state of light and generation of light with continuously rotating linear polarization

2019

We present a technique for generating light in an arbitrary polarization state. The technique is based on interference of two orthogonally polarized light beams, whose amplitudes and phases are controlled with a Mach-Zehnder inteferometer with acousto-optic modulators (AOMs) placed in each arm. We demonstrate that via control over amplitudes, phases, and frequencies of acoustic waves driving the AOMs, any polarization state can be synthesized. In particular, we demonstrate generation of linearly polarized light, whose polarization plane continuously rotates at a rate from 1 kHz to 1 MHz. Such light finds applications in science (e.g., investigations of Bloch-Siegert effect) and technology (…

010302 applied physicsPhysicsPolarization planebusiness.industryLinear polarizationMagnetometerLinearly polarized lightFOS: Physical sciencesAcoustic wavePhysics - Applied PhysicsApplied Physics (physics.app-ph)Polarization (waves)01 natural sciences010305 fluids & plasmaslaw.inventionAmplitudeOpticslaw0103 physical sciencesOptical rotationbusinessInstrumentationPhysics - OpticsOptics (physics.optics)
researchProduct

Time resolved measurements of hydrogen ion energy distributions in a pulsed 2.45 GHz microwave plasma

2017

A plasma diagnostic study of the Ion Energy Distribution Functions (IEDFs) of H+, H+2H2+, and H+3H3+ ions in a 2.45 GHz hydrogen plasma reactor called TIPS is presented. The measurements are conducted by using a Plasma Ion Mass Spectrometer with an energy sector and a quadrupole detector from HIDEN Analytical Limited in order to select an ion species and to measure its energy distribution. The reactor is operated in the pulsed mode at 100 Hz with a duty cycle of 10% (1 ms pulse width). The IEDFs of H+, H+2H2+, and H+3H3+ are obtained each 5 μs with 1 μs time resolution throughout the entire pulse. The temporal evolution of the plasma potential and ion temperature of H+ is derived from the d…

010302 applied physicsPhysicsRange (particle radiation)plasma sourcesta114plasma diagnosticsPlasmaCondensed Matter PhysicsMass spectrometry01 natural sciences7. Clean energyIon source010305 fluids & plasmasIonplasma dynamicsPhysics::Plasma Physics0103 physical sciencesThermal emittancePlasma diagnosticsionAtomic physicsMicrowaveplasma sheathsPhysics of Plasmas
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Charge breeding at GANIL: Improvements, results, and comparison with the other facilities

2019

International audience; The 1+/n+ method, based on an ECRIS charge breeder (CB) originally developed at the LPSC laboratory, is now implemented at GANIL for the production of Radioactive Ion Beams (RIBs). Prior to its installation in the middle of the low energy beam line of the SPIRAL1 facility, the 1+/n+ system CB has been modified based on the experiments performed on the CARIBU Facility at Argone National Laboratory. Later, it has been tested at the 1+/n+ LPSC test bench to validate its operation performances. Charge breeding efficiencies as well as charge breeding times have been measured for noble gases and alkali elements. The commissioning phase started at GANIL in the second half-y…

010302 applied physicsPhysicsTest benchRange (particle radiation)mechanical instrumentstutkimuslaitteetCyclotronThermal ionization01 natural sciences7. Clean energyIon source010305 fluids & plasmaslaw.inventionNuclear physicsion sourcesUpgradeBreeder (animal)Beamlinenuclear physicslawion beam mass spectrometer0103 physical sciences[PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]ydinfysiikkaInstrumentation
researchProduct

Self-consistent non-stationary theory of the gyrotron

2016

For a long time, the gyrotron theory was developed assuming that the transit time of electrons through the interaction space is much shorter than the cavity fill time. Correspondingly, it was assumed that during this transit time, the amplitude of microwave oscillations remains constant. A recent interest to such additional effects as the after-cavity interaction between electrons and the outgoing wave in the output waveguide had stimulated some studies of the beam-wave interaction processes over much longer distances than a regular part of the waveguide which serves as a cavity in gyrotrons. Correspondingly, it turned out that the gyrotron theory free from the assumption about constant amp…

010302 applied physicsPhysicsWaveguide (electromagnetism)Plane (geometry)ElectronCondensed Matter Physics01 natural sciences010305 fluids & plasmaslaw.inventionMagnetic fieldAmplitudelawGyrotronQuantum electrodynamicsQuantum mechanics0103 physical sciencesConstant (mathematics)MicrowavePhysics of Plasmas
researchProduct

Effects of magnetic configuration on hot electrons in a minimum-B ECR plasma

2020

International audience; To investigate the hot electron population and the appearance of kinetic instabilities in highly charged electron cyclotron resonance ion source (ECRIS), the axially emitted bremsstrahlung spectra and microwave bursts emitted from ECRIS plasma were synchronously measured on SECRAL-II (Superconducting ECR ion source with Advanced design in Lanzhou No. II) ion source with various magnetic field configurations. The experimental results show that when the ratio of the minimum field to the resonance field (i.e. Bmin/Becr ) is less than ~0.8, the bremsstrahlung spectral temperature Ts increases linearly with the Bmin/Becr –ratio when the injection, extraction and radial mi…

010302 applied physicsPhysics[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceBremsstrahlungResonancePlasmaCondensed Matter Physics01 natural sciencesElectromagnetic radiationElectron cyclotron resonance010305 fluids & plasmasMagnetic fieldNuclear Energy and Engineering0103 physical sciencesAtomic physicsMicrowave
researchProduct

Hydrogen plasma induced photoelectron emission from low work function cesium covered metal surfaces

2017

Experimental results of hydrogen plasma induced photoelectron emission from cesium covered metal surfaces under ion source relevant conditions are reported. The transient photoelectron current during the Cs deposition process is measured from Mo, Al, Cu, Ta, Y, Ni, and stainless steel (SAE 304) surfaces. The photoelectron emission is 2–3.5 times higher at optimal Cs layer thickness in comparison to the clean substrate material. Emission from the thick layer of Cs is found to be 60%–80% lower than the emission from clean substrates. peerReviewed

010302 applied physicsPhysicsta114HydrogenTantalumAnalytical chemistrytransitionchemistry.chemical_elementSubstrate (electronics)plasmasCondensed Matter Physics01 natural sciencesIon sourcework functions010305 fluids & plasmasion sourceschemistryAluminiumCaesium0103 physical sciencesWork functionLayer (electronics)photoemissionPhysics of Plasmas
researchProduct

Cyclotron instability in the afterglow mode of minimum-B ECRIS.

2016

It was shown recently that cyclotron instability in non-equilibrium plasma of a minimum-B electron cyclotron resonance ion source (ECRIS) causes perturbation of the extracted ion current and generation of strong bursts of bremsstrahlung emission, which limit the performance of the ion source. The present work is devoted to the dynamic regimes of plasma instability in ECRIS operated in pulsed mode. Instability develops in decaying plasma shortly after heating microwaves are switched off and manifests itself in the form of powerful pulses of electromagnetic emission associated with precipitation of high energy electrons. Time-resolved measurements of microwave emission bursts are presented. I…

010302 applied physicsPhysicsta114ta213Astrophysics::High Energy Astrophysical Phenomenaplasma instabilityCyclotronBremsstrahlungPlasma01 natural sciencesInstabilityIon sourceElectron cyclotron resonance010305 fluids & plasmaslaw.inventionTwo-stream instabilityPhysics::Plasma Physicslaw0103 physical scienceselectron cyclotron resonance ion sourcesAtomic physicsInstrumentationIon cyclotron resonanceThe Review of scientific instruments
researchProduct