Search results for "NONE"

showing 10 items of 1921 documents

Relaxation induced by milrinone and rolipram in human penile arteries and veins

2002

Abstract We studied the relaxant effects of milrinone, an inhibitor of phosphodiesterase 3, and rolipram, an inhibitor of phosphodiesterase 4, on contracted human penile dorsal artery and deep dorsal vein. Vascular rings from 12 multi-organ donors were suspended in organ baths for isometric recording of tension. Both milrinone and rolipram inhibited (100%) the contraction induced by noradrenaline and shifted the relaxation–response curves to the cAMP forming agents prostaglandin E1 and forskolin to the left. The findings indicate that the cAMP pathway appears to be a main determinant of relaxation in human penile vessels.

AdultMalemedicine.medical_specialtyPhosphodiesterase InhibitorsPhosphodiesterase 3Penile arteryBiologyMuscle Smooth Vascularchemistry.chemical_compoundInternal medicinemedicineHumansDrug InteractionsChildProstaglandin E1RolipramPharmacologyForskolinDose-Response Relationship DrugColforsinMiddle AgedVasodilationEndocrinologymedicine.anatomical_structurechemistryCirculatory systemMilrinoneRolipramMilrinonePenisBlood vesselmedicine.drugEuropean Journal of Pharmacology
researchProduct

Statin therapy and plasma coenzyme Q10 concentrations—A systematic review and meta-analysis of placebo-controlled trials

2015

Statin therapy may lower plasma coenzyme Q10 (CoQ10) concentrations, but the evidence as to the significance of this effect is unclear. We assessed the impact of statin therapy on plasma CoQ10 concentrations through the meta-analysis of available RCTs. The literature search included selected databases up to April 30, 2015. The meta-analysis was performed using either a fixed-effects or random-effect model according to I(2) statistic. Effect sizes were expressed as weighted mean difference (WMD) and 95% confidence interval (CI). The data from 8 placebo-controlled treatment arms suggested a significant reduction in plasma CoQ10 concentrations following treatment with statins (WMD: -0.44 μmol/…

AdultMalemedicine.medical_specialtyUbiquinoneAtorvastatinPharmacologyPlaceboGastroenterologychemistry.chemical_compoundDouble-Blind MethodInternal medicineHumansMedicineRosuvastatinClinical significanceAgedRandomized Controlled Trials as TopicPharmacologyCoenzyme Q10business.industryMiddle AgedPlacebo EffectConfidence intervalchemistrySimvastatinCase-Control StudiesFemaleHydroxymethylglutaryl-CoA Reductase InhibitorsbusinessPravastatinmedicine.drugPharmacological Research
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Olfactory Event-Related Potentials Reflect Individual Differences in Odor Valence Perception

2006

Investigating the neural substrates of perceived quality in olfaction using different odorants is intrinsically difficult. By utilizing individual differences in perceived quality of the odor of androstenone, we obtained a continuum of individual differences in rated valence of the same stimulus allowing investigations of its manifestation in the olfactory event-related potentials (ERPs). In an initial group consisting of 43 individuals that were screened for their verbal descriptors and sensitivity for the odor of androstenone, 22 normosmic volunteers were chosen forming 2 distinct groups with regard to verbal labels (‘‘body odor'' and ‘‘nonbody odor'') for androstenone while maintaining c…

Adultmedicine.medical_specialtyAdolescentPhysiologyandrostenonemedia_common.quotation_subjectOlfactionStimulus (physiology)AudiologyAndrosterone050105 experimental psychologyDevelopmental psychologypleasantness03 medical and health sciencesBehavioral Neurosciencechemistry.chemical_compound0302 clinical medicineEvent-related potentialPhysiology (medical)PerceptionmedicineHumans0501 psychology and cognitive sciencesvalenceValence (psychology)Evoked PotentialsLate positive componentmedia_common[SCCO.NEUR]Cognitive science/Neurosciencemusculoskeletal neural and ocular physiology05 social sciencesAndrostenoneOlfactory PathwaysMiddle AgedSensory SystemsElectrophysiologyOdorchemistryqualitySensory ThresholdsOdorants[ SCCO.NEUR ] Cognitive science/NeuroscienceFemalePsychologypsychological phenomena and processes030217 neurology & neurosurgeryhedonicolfactionChemical Senses
researchProduct

Upgrading cytochrome P450 activity in HepG2 cells co-transfected with adenoviral vectors for drug hepatotoxicity assessment

2011

In a number of adverse drug reactions leading to hepatotoxicity, drug metabolism is thought to be involved by the generation of reactive metabolites from non-toxic drugs. The use of hepatoma cell lines, such as HepG2 cell line, for the evaluation of drug-induced hepatotoxicity is hampered by their low cytochrome P450 expression which makes impossible the study of the toxicity produced by bioactivable compounds. Genetically manipulated cells constitute promising tools for hepatotoxicity applications. HepG2 cells were simultaneously transfected with recombinant adenoviruses encoding CYP1A2, CYP2C9 and CYP3A4 to confer them drug-metabolic competence. Upgraded cells (Adv-HepG2) were highly able…

Aflatoxin B1Cell SurvivalGenetic VectorsPharmacologyTransfectionToxicologyModels BiologicalCitric AcidCalcium in biologyAdenoviridaeCytochrome P-450 CYP1A2RotenoneCytochrome P-450 CYP3AHumansViability assayCytochrome P-450 CYP2C9Membrane Potential MitochondrialCYP3A4biologyChemistryCYP1A2Cytochrome P450Hep G2 CellsGeneral MedicineTransfectionBiochemistryHigh-content screeningbiology.proteinCalciumAryl Hydrocarbon HydroxylasesChemical and Drug Induced Liver InjuryDrug metabolismToxicology in Vitro
researchProduct

Presence of mycotoxin in commercial infant formulas and baby foods from Italian market

2014

In this study a total of 75 commercially Italian samples of baby foods, including 13 infant formula milks (infant formula powders, ready-to-use preparation), 11 dairy products (cheese and yogurt), 25 cereal-based baby foods, 16 fruit and vegetables compotes, and 10 fruit and vegetables purees (composed of pear, peach, banana and for apple), were analyzed to provide an overview on mycotoxin presence. The presence was carried out by evaluating of 23 mycotoxins: ochratoxin-A (OTA), patulin (PAT), two aflatoxins (AFM1, AFB1), three zearalenones (ZONs), which include zearalenone (ZON) and its metabolites (α-zearalenol (α-ZOL) and β-zearalenol (β-ZOL)), nine trichothecenes: deoxynivalenol (DON), …

AflatoxinChemistryTrichotheceneDiacetoxyscirpenolmycotoxinPatulinBaby foodchemistry.chemical_compoundInfant formulababy foodFood scienceMycotoxinZearalenoneFood ScienceBiotechnologyFood Control
researchProduct

Il sacrificio di Ifigenia fra Ditti-Settimio e Draconzio

2022

L’intervento si propone una disamina dell’episodio di Ifigenia nell’«Orestis tragoedia», presentato e analizzato sia in rapporto alla tradizione classica – in particolare, ovviamente, quella latina – tenuta presente da Draconzio nella delineazione della vicenda e nella presentazione della figura della figlia di Agamennone, sia in rapporto con la tradizione tardo-antica, in particolare con la narrazione di Ditti-Settimio. Attraverso l’analisi dell’episodio in questione, si cerca di mettere in risalto i fattori di continuità e di innovazione nel trattamento del mito di Ifigenia (e dei miti classici in generale) da parte del poeta africano. The intervention proposes an examination of the episo…

AgamemnonAgamennoneSettore L-FIL-LET/08 - Letteratura Latina Medievale E UmanisticaTroian MythDracontiuDraconzioIfigeniaDitti-Settimiomiti troianiDictys-Septimiu«Orestis tragoedia»IphigeniaClassical Traditiontradizione classica
researchProduct

Determination of butyl methoxydibenzoylmethane, benzophenone-3, octyl dimethyl PABA and octyl methoxycinnamate in lipsticks.

2003

The complex composition of lipstick formulations usually needs the use of organic solvents for sample dissolution. A treatment based on dissolution of cosmetic samples in ethanol-water (70 : 30, v/v) by use of ultrasonic irradiation is proposed. A C(18) stationary phase and an isocratic mobile phase of ethanol:water:acetic acid (70 : 29.5 : 0.5, v/v/v) with a flow rate of 1 mL min(-1) and an injection volume of 20 microL is proposed for the high-pressure liquid chromatography (HPLC) determination of four UV-filters, and detection was carried out at 309 nm. The limit of the chromatographic detection was 7.0 microg mL(-1) for butyl methoxydibenzoylmethane, 1.5 microg mL(-1) for benzophenone-3…

AgingChromatographyEthanolPharmaceutical ScienceOctyl methoxycinnamateDermatologyLipstickHigh-performance liquid chromatographyAcetic acidchemistry.chemical_compoundColloid and Surface ChemistrychemistryChemistry (miscellaneous)Drug DiscoveryBenzophenoneOxybenzoneTetrahydrofuranInternational journal of cosmetic science
researchProduct

Randomized, double-blind, placebo controlled, multicentre study of idebenone in patients suffering from multi-infarct dementia

1992

Abstract In this randomized double-blind, placebo controlled, multicentre study on 108 elderly patients with mild to moderate mental deterioration of vascular origin, idebenone — a benzoquinone derivative with a hydroxyalkyl side chain — proved to be therapeutically effective in the treatment of multi-infarct dementia. The oral administration of idebenone 45 mg/day b.i.d. for 120 days significantly improved the scores of the following test in comparison with placebo: Mini Mental State, Randt Memory Test, Gottfries Rating Scale, Token Test, Toulouse Pieron Test, indicating improvements in memory attention and cognitivity. The drug was well tolerated and effective in patients with multi-infar…

Agingmedicine.medical_specialtyHealth (social science)Vascular diseaseCerebral infarctionbusiness.industrymedicine.diseasePlaceboClinical trialOral administrationRating scaleAnesthesiamedicinePhysical therapyIdebenoneDementiaGeriatrics and GerontologybusinessGerontologymedicine.drugArchives of Gerontology and Geriatrics
researchProduct

Idebenone in senile dementia of Alzheimer type: A multicentre study

1992

Idebenone is a new cerebro-active drug, effective in dementia disorders, particularly indicated in primary degenerative dementias, i.e. Alzheimer's disease. This new molecule acts as an electron trapper and a free radical scavenger protecting mitochondrial membranes from lipid peroxidation. A multicentric, double-blind trial of idebenone (45 mg twice daily orally) vs. placebo was carried out on 102 elderly patients affected by Alzheimer-type dementia of mild or moderate severity. Idebenone was administered for 4 consecutive months, 45 mg twice daily. Clinical evaluations were performed at the time of enrollment (t0) and monthly thereafter (t30, t60, t90 and t120) and at follow-up (t150 ). T…

Agingmedicine.medical_specialtyHealth (social science)business.industrymedicine.diseasePlaceboFree radical scavengerSurgeryClinical trialDegenerative diseaseTolerabilityInternal medicineMedicineDementiaIdebenoneGeriatrics and GerontologyAlzheimer's diseasebusinessGerontologymedicine.drugArchives of Gerontology and Geriatrics
researchProduct