Search results for "PII"

showing 10 items of 437 documents

Endoplasmic Reticulum stress reduces COPII vesicle formation and modifies Sec23a cycling at ERESs

2013

AbstractExit from the Endoplasmic Reticulum (ER) of newly synthesized proteins is mediated by COPII vesicles that bud from the ER at the ER Exit Sites (ERESs). Disruption of ER homeostasis causes accumulation of unfolded and misfolded proteins in the ER. This condition is referred to as ER stress. Previously, we demonstrated that ER stress rapidly impairs the formation of COPII vesicles. Here, we show that membrane association of COPII components, and in particular of Sec23a, is impaired by ER stress-inducing agents suggesting the existence of a dynamic interplay between protein folding and COPII assembly at the ER.

Vesicular Transport ProteinsBiophysicsEndoplasmic ReticulumBiochemistryCell LineVesicular Transport ProteinGeneticStructural BiologyERESGeneticsVesicular Transport ProteinsHumansCOPIIEndoplasmic Reticulum StreMolecular BiologyCOPIIChemistryVesicleEndoplasmic reticulumSec23Cell BiologyCOP-Coated VesiclesSEC23AEndoplasmic Reticulum StressCell biologyBiophysicUnfolded protein responseER streProtein foldingCOP-Coated VesiclesER stressCOP-Coated VesicleHumanProtein BindingFEBS Letters
researchProduct

Associations between age and cognitive foundation skills in the Nordic countries : a closer look at the data

2014

aikuiskoulutuskognitiiviset taidottyökokemusPohjoismaatPISA-tutkimusammatillinen kehitystyössäoppiminentestitoppimistuloksetammatillinen aikuiskoulutusPIIAC-tutkimusaikuiset
researchProduct

Neighborhood resources associated with active travel in older adults: A cohort study in six European Countries

2020

Objectives: To study associations between perceived neighborhood resources and time spent by older adults in active travel. Methods: Respondents in six European countries, aged 65–85 years, reported on the perceived presence of neighborhood resources (parks, places to sit, public transportation, and facilities) with response options “a lot,” “some,” and “not at all.” Daily active travel time (total minutes of transport-related walking and cycling) was self-reported at the baseline (n = 2,695) and 12–18 months later (n = 2,189). Results: Reporting a lot of any of the separate resources (range B’s = 0.19–0.29) and some or a lot for all four resources (B = 0.22, 95% confidence interval [0.09, …

aktiivisuusBuilt environmentrakennettu ympäristöPsychological interventionasuinympäristöPhysical Therapy Sports Therapy and Rehabilitationnaapurusto/dk/atira/pure/sustainabledevelopmentgoals/sustainable_cities_and_communities03 medical and health sciences0302 clinical medicineactive transport030212 general & internal medicineBaseline (configuration management)Built environmentMobility030505 public healthbusiness.industryRehabilitationaktiivinen ikääntyminenbuilt environmentConfidence intervalmobilitySDG 11 - Sustainable Cities and Communitieselinpiirit (biologia)Travel timeliikkuvuusPublic transportGeriatrics and Gerontology0305 other medical sciencePsychologybusinessActive transportGerontologyhuman activitiesfyysinen aktiivisuusikääntyneetDemographyCohort study
researchProduct

Ole hiljaa ja osallistu! : pienoisetnografia kuudennen luokan oppilaiden luokkahuonekäyttäytymisestä ja siihen vaikuttavista tekijöistä

2005

aktiivisuuspiilo-opetussuunnitelmatetnografiakoulukäyttäytyminenlapsetosallistuminen
researchProduct

Opiskelijoiden kokemuksia ja käsityksiä alisuorittamisesta opettajankoulutuslaitoksen kulttuurisena piirteenä

2010

Tämän tutkielman aiheena oli alisuorittaminen Jyväskylän opettajankoulutuslaitoksen kulttuurisena piirteenä. Tutkimuksessa selvitettiin, millaisia alisuorittamisen syitä ilmenee opiskelijoiden haastatteluissa. Tutkimusaineisto kerättiin syvähaastattelumetodilla yhdeksältä luokanopettajaopiskelijalta. Aineistonanalyysi oli aineistolähtöistä. Analyysimetodina hyödynnettiin teemoittelua. Tutkimusongelma muotoutui täsmälliseksi teemoittelun muuttuessa tarkemmaksi. Tutkimuksessa löydettiin viisi syytä, jotka aiheuttavat alisuorittamista. Syyt liittyvät vaatimustasoon, palautteeseen ja arviointiin, opetukseen, opettajien asenteeseen sekä vertaisryhmään. Vaatimustaso koetaan ristiriitaisena. Pääsä…

alisuoriutuminenpiilo-opetussuunnitelmatHaastattelututkimusyliopistokulttuuripiilo-opetussuunnitelmaopettajankoulutusyliopistopedagogiikka
researchProduct

Need adapted use of medication in the open dialogue approach for psychosis : a descriptive longitudinal cohort study

2022

Background The open dialogue (OD) approach includes the need-adapted use of psychiatric medication in treating first-episode psychosis (FEP), but there is limited information on how psychiatric medications are actually used in OD-based services. This study aims to analyse long-term medication dispensing patterns among FEP cohort treated according to the OD. Methods The OD cohort consisted of people who received treatment for FEP in the Finnish Western Lapland catchment area at a time of OD implementation (n=61). The comparison group included people whose FEP treatment commenced outside the catchment area during the mid-1990s (n=1378). Data were gathered from national registers from onset to…

anxiolyticsskitsofreniapsykoositrisk–benefit ratioAntidepressantspitkittäistutkimusAvoimen dialogin hoitomallischizophreniaPsychiatry and Mental healthantipsychoticspsykiatrinen hoitomielenterveyshäiriötopen dialogmasennuslääkkeetODkohorttitutkimusbentsodiatsepiinitneuroleptit
researchProduct

Relationships between personality traits and values in middle aged men and women

2018

The present study analyzed the relations between the Big Five personality traits (neuroticism, extraversion, agreeableness, conscientiousness, and openness to experience) and 14 values (societal concern, tolerance, protecting nature, caring, dependability, autonomy of thought, autonomy of action, stimulation, hedonism, achievement, tradition, security, conformity, and power) in middle-aged women and men. The 50-year-old participants (women n = 107 and men n = 105) were drawn from the ongoing Finnish Jyväskylä Longitudinal Study of Personality and Social Development. The personality traits were assessed using the 60-item NEO Five Factor Inventory. Values were measured using the 46-item versi…

arvot (käsitykset)Big Five personality traitkeski-ikävaluesmiddle-agepersoonallisuuden piirteetsukupuoli
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

Elementary School Teachers' Experiences of Implementing the Teacher Classroom Management Method - Case Study in Finland

2023

The diversity of pupils and their different difficulties challenge teachers' skills and methods in teaching. Some behavioral challenges require rapid intervention and a multidisciplinary and interdisciplinary approach from the teachers. An internationally recognized tool, TCM (Teacher Classroom Management), aims to support pupils' socio-emotional development, improve teacher-pupil interaction, and strengthen school-home cooperation. This pilot study examines teachers' experiences of TCM in Finnish primary school context. The study is qualitative, and the data (N=16) was collected through focus group interviews. According to the results, the teacher's strengthened group management skills wer…

behavioral responseluokanopettajatpupilluokkatyöskentelyGeneral MedicineilmapiiriSustainable well-beingTeacher Classroom Management Methodalakouluongelmakäyttäytyminenluokkayhteisöelementary schoolteacheropettaja-oppilassuhdeInternational Journal on Studies in Education
researchProduct

Genus Indiopius Fischer, 1966 (Hymenoptera, Braconidae, Opiinae) in Iran with a key to the world species

2014

The Iranian species belonging to the genus Indiopius Fischer are reviewed. A description of the first recorded female of I. cretensis Fischer, 1966 is provided. A key to the world species of the genus Indiopius is given.

biologynew recordsZoologyHymenopteraIranbiology.organism_classificationArticleBraconidaekeyGenuslcsh:ZoologyIndiopiusKey (lock)Animal Science and Zoologylcsh:QL1-991BraconidaeOpiinaeEcology Evolution Behavior and SystematicsZooKeys
researchProduct