Search results for "PPAR"

showing 10 items of 1686 documents

Adherence to omalizumab: A multicenter “real-world” study

2020

Background: Adherence to medications is crucial in patients with severe asthma in light of the negative clinical impact and costs of non-adherence. Adherence to omalizumab has not been well studied in real-world settings. The aim of this study was to assess adherence to omalizumab and evaluate treatment effectiveness in relation to adherence. Methods: This was a retrospective, observational, and multicenter real-world study. Omalizumab dose, timing of administration, and duration of treatment ( 4 years) were analyzed. Adherence was evaluated by examining rates of expected and missing doses. Good adherence (10% doses missed) were determined. For effectiveness in relation to adherence of omal…

lcsh:Immunologic diseases. AllergyPulmonary and Respiratory Medicinemedicine.medical_specialtySevere asthmaEfficacySevere asthmaImmunologyOmalizumabOmalizumabSettore MED/10 - Malattie Dell'Apparato RespiratorioArticlePoor adherence03 medical and health sciences0302 clinical medicineInternal medicineImmunology and AllergyMedicineIn patient030223 otorhinolaryngologyAsthmaAsthma exacerbationsbusiness.industrySevere asthma Omalizumab Adherence Efficacy Real-worldmedicine.disease030228 respiratory systemReal-worldAdherenceObservational studylcsh:RC581-607businessAsthma Control Testmedicine.drug
researchProduct

Leukotriene B4-loaded microspheres: a new therapeutic strategy to modulate cell activation

2008

AbstractBackgroundLeukotriene B4(LTB4) is a potent inflammatory mediator that also stimulates the immune response. In addition, it promotes polymorphonuclear leukocyte phagocytosis, chemotaxis, chemokinesis and modulates cytokines release. Regarding chemical instability of the leukotriene molecule, in the present study we assessed the immunomodulatory activities conferred by LTB4released from microspheres (MS). A previous oil-in-water emulsion solvent extraction-evaporation method was chosen to prepare LTB4-loaded MS.ResultsIn the mice cremasteric microcirculation, intraescrotal injection of 0.1 ml of LTB4-loaded MS provoked significant increases in leukocyte rolling flux, adhesion and emig…

lcsh:Immunologic diseases. Allergymedicine.medical_specialtyLeukotriene B4ImmunologyChemokinesisLeukocyte RollingBiologyPharmacologyNitric OxideLeukotriene B4Nitric oxideMicechemistry.chemical_compoundCell MovementInternal medicineCell AdhesionLeukocytesmedicineAnimalsHumansLeukocyte RollingPPAR alphaLungChemokine CCL2NitritesLeukotrieneMonocyteEndothelial CellsChemotaxisMicrospheresEndocrinologymedicine.anatomical_structurechemistryMacrophages Peritoneallipids (amino acids peptides and proteins)Cell activationlcsh:RC581-607Research ArticleBMC Immunology
researchProduct

Fever and dyspnoea in a tracheostomised patient

2020

A 65-year-old man was referred for evaluation of acute onset of fever, productive cough and dyspnoea. He had previously received a diagnosis of laryngeal carcinoma, which had been treated with laryngectomy and bilateral laterocervical lymphadenectomy, followed by chemotherapy. He underwent plastic surgery of the laryngocutaneous fistula, and a positron emission tomography (PET)- computed tomography (CT) examination performed during follow-up showed 18-FDG (2-fluoro-2-deoxyd- glucose) lung uptake in the apical right portion. He had a smoking history and his regular medications included dexamethasone, metoclopramide, omeprazole, furosemide, cholecalciferol and pregabalin. He had a history of …

lcsh:RC705-779Pulmonary and Respiratory Medicinemedicine.medical_specialtybusiness.industrylung fibrosisMEDLINECase Reportlcsh:Diseases of the respiratory systemtomographySettore MED/10 - Malattie Dell'Apparato RespiratorioExpert Opinionoilrespiratory tract diseases18Emergency medicineMedicinebusiness
researchProduct

Acromion clavicular joint reconstruction with LArS ligament in acute dislocation

2019

Background: The acromion clavicular joint dislocations are common injuries of the shoulder. The severity is dependent upon the degree of ligamentous injury. Surgical treatment is typically performed in higher grade acromioclavicular separation with several static and dynamic operative procedures with or without primary ligament replacement. Methods: 47 patients with acute Rockwood type III, IV, and V injuries were treated surgically with LARS reconstruction. The success of technique was evaluated by radiographic outcomes for each patient at every follow-up visit (one,three, 12 months), while to assess pain reduction and clinical evaluation Visual Analogue scale score (VAS) and Constant-Murl…

lcsh:RD701-811lcsh:Orthopedic surgerySettore MED/33 - Malattie Apparato Locomotorecoracoid procecoracoclavicular ligament reconstructionacromionclavicular jointshoulder injurycoracoid process
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Jurisdiction in cases of divorce, legal separation or marriage annulment

2021

The subject of coordination is fundamental for the functioning of jurisdictional rules of the Regulation n.2016/1103 on matrimonial property regimes and Regulation n.2016/1104 on the property consequences of registered partnerships. Both Property Regimes Regulations have the purpose of gathering litigation before the courts of one Member State and have the related procedures managed by the courts of the same Member State. Recital 34 of Regulation No. 2016/1103 specifies that matters of matrimonial property regime related to proceedings pending before the court of a member state hearing an application for divorce, legal separation or marriage annulment should be dealt with by the courts of t…

legal separation or marriage annulmentlegal separation or marriage annulment Calabresethe concentration of jurisdiction should not be allowed without the spouses? agreement?. Unfortunatelyinternational familiesthe purpose of concentrating the proceedings is not always met. The Eu system of private international law in family matters has gradually extended its terms of reference from divorce and legal separation to the financial aspects of family lifeat least for the Member States that will take part in the enhanced cooperation. Nonethelessdivorcefamilias internacionaleslegal separation or marriage annulment may only be based on specific grounds of jurisdiction. In such casesjurisdictionlegal separation or marriage annulment should be dealt with by the courts of that Member Statepractically these topics are often addressed in the same action for divorce. Issues such as assigning the matrimonial homeit seems reasonable and in the parties? interests to have divorce and the related financial aspects handled by the same court. Coordinationconcentración de procedimientosCoordinacióndivorcioprocedimientos relacionados?unless the jurisdiction to rule on the divorceacuerdos 52 63:CIENCIAS JURÍDICAS [UNESCO]Cinzia The subject of coordination is fundamental for the functioning of jurisdictional rules of the Regulation n.2016/1103 on matrimonial property regimes and Regulation n.2016/1104 on the property consequences of registered partnerships. Both Property Regimes Regulations have the purpose of gathering litigation before the courts of one Member State and have the related procedures managed by the courts of the same Member State. Recital 34 of Regulation No. 2016/1103 specifies that matters of matrimonial property regime related to proceedings pending before the court of a member state hearing an application for divorceagreements.UNESCO::CIENCIAS JURÍDICASand to the conditions and reasons that ground that ruling. The need to coordinate between the EU instruments becomes apparent because spouses litigate over the financial consequences of divorce. As a result2386-4567 22661 Actualidad jurídica iberoamericana 587897 2021 15 8113548 Jurisdiction in cases of divorcerelated procedurescompetenciaand the definition of the obligation of one spouse to support the other financially are strongly and substantially connected to the ruling on divorceconcentrating proceedingsseparación legal o anulación matrimonial
researchProduct

Chirurgia refrattiva della cataratta e lenti multifocali

2010

lenti multifocalichirurgia refrattivaSettore MED/30 - Malattie Apparato Visivocataratta
researchProduct

Lesioni traumatiche delle parti molli

2011

lesione delle parti molli lesioni tendinee lesione muscolariSettore MED/33 - Malattie Apparato Locomotore
researchProduct

Lesioni ostetriche della spalla

2011

lesioni ostetriche della spalla paralisi ostetricheSettore MED/33 - Malattie Apparato Locomotore
researchProduct

A New Perspective on the Textile and Apparel Industry in the Digital Transformation Era

2022

The textile and apparel (fashion) industry has been influenced by developments in societal socio-cultural and economic structures. Due to a change in people’s preferences from economic functionality to supra-functionality beyond economic value, the fashion industry is at the forefront of digitalization. The growing digitalization in the fashion industry corresponds to digital fashion, which can satisfy the rapid shift in consumers’ preferences. This paper explores the evolving con-cept of innovations in digital fashion in the textile and apparel industry. Specifically, it centers on the evaluation of Amazon’s digital fashion initiatives, which have made the platform the Un…

liiketoimintamallitAmazon; textile and apparel; fashion; advanced digital fashions; supra-omnichannel; non-contact society; beyond e-commercenon-contact societyvaateteollisuustextile and appareltekstiiliteollisuusbeyond e-commerceadvanced digital fashionstekoälymuotialainnovaatiotfashionsupra-omnichannelmuotiGeneral Earth and Planetary SciencesdigitalisaatioAmazonGeneral Environmental ScienceTextiles; Volume 2; Issue 4; Pages: 633-656
researchProduct