Search results for "Pyrrolidinone"

showing 10 items of 37 documents

Ergosterol elicits oxidative burst in tobacco cells via phospholipase A2 and protein kinase C signal pathway

2004

Ergosterol, a typical fungal sterol, induced in tobacco (Nicotiana tabacum L. cv. Xanthi) suspension cells the synthesis of reactive oxygen species and alkalization of the external medium that are dependent on the mobilization of calcium from internal stores. We used specific inhibitors to elucidate the signal pathway triggered by ergosterol compared with cryptogein, a proteinaceous elicitor of Phytophthora cryptogea. HerbimycinA and genistein, inhibitors of tyrosine protein kinases, had no effect on the oxidative burst and pH changes induced by bothelicitors.Similarly,H-89,aninhibitorofproteinkinaseA,hadnoeffectontheinductionofthesedefensereactions.However,theresponse to both elicitors was…

0106 biological sciencesTime FactorsCell SurvivalPhysiologyPlant Science01 natural sciencesPhospholipases AFungal Proteins03 medical and health scienceschemistry.chemical_compoundPhospholipase A2ErgosterolPROTEINE KINASE CTobacco[SDV.BBM] Life Sciences [q-bio]/Biochemistry Molecular Biologypolycyclic compoundsGenetics[SDV.BBM]Life Sciences [q-bio]/Biochemistry Molecular BiologyEnzyme InhibitorsEstrenesProtein kinase ACells CulturedProtein Kinase CProtein kinase CComputingMilieux_MISCELLANEOUS030304 developmental biologySulfonamides0303 health sciencesErgosterolbiologyPhospholipase CAlgal ProteinsNeomycinIsoquinolinesPyrrolidinonesSterolElicitorRespiratory burstOxidative StressPhospholipases A2chemistryBiochemistryType C Phospholipasesbiology.proteinlipids (amino acids peptides and proteins)Signal Transduction010606 plant biology & botany
researchProduct

Postnatal development of the dopaminergic signaling involved in the modulation of intestinal motility in mice

2015

Background:Since antidopaminergic drugs are pharmacological agents employed in the management of gastrointestinal motor disorders at all ages, we investigated whether the enteric dopaminergic system may undergo developmental changes after birth.Methods:Intestinal mechanical activity was examined in vitro as changes in isometric tension.Results:In 2-d-old (P2) mice, dopamine induced a contractile effect, decreasing in intensity with age, replaced, at the weaning (day 20), by a relaxant response. Both responses were tetrodotoxin (TTX)-insensitive. In P2, dopaminergic contraction was inhibited by D1-like receptor antagonist and mimicked by D1-like receptor agonist. In 90-d-old (P90) mice, the …

0301 basic medicineAgonistmedicine.medical_specialtyGastrointestinal Diseasesmedicine.drug_classDopamineTetrodotoxinBiologySettore BIO/09 - FisiologiaEnteric Nervous SystemMice03 medical and health sciences0302 clinical medicineDopamine receptor D3DopamineInternal medicineIntestine SmallCyclic AMPmedicineAnimalsEstrenesReceptorDopaminergicReceptor antagonistPyrrolidinonesMice Inbred C57BL030104 developmental biologyEndocrinologyAnimals NewbornDopamine receptorType C PhospholipasesDideoxyadenosinePediatrics Perinatology and Child Health2345-Tetrahydro-78-dihydroxy-1-phenyl-1H-3-benzazepineSignal transductionGastrointestinal Motility030217 neurology & neurosurgerySignal Transductionmedicine.drugPediatric Research
researchProduct

Solid microcrystalline dispersion films as a new strategy to improve the dissolution rate of poorly water soluble drugs: A case study using olanzapine

2016

In this study, we evaluate the dissolution rate enhancement of solid microcrystalline dispersion (SMD) films of olanzapine (OLZ) formulated with four water-soluble polymers namely poly(N-vinylpyrrolidone) (PVP), poloxamer 188 (P188), poloxamer 407 (P407) and Soluplus(®) (SLP). Prepared formulations were characterised to determine particle size, morphology, hydrogen bonding interactions, thermal characteristics as well as in vitro dissolution studies conducted under sink conditions (pH 6.8). Particle size of OLZ in all formulations ranged between 42 and 58μm. Attenuated Total Reflectance Fourier Transform Infrared spectroscopy (ATR-FTIR), Differential Scanning Calorimetry (DSC) and Hot-Stage…

3003PVPDrug CompoundingSolid microcrystalline dispersionPharmaceutical SciencePoloxamer02 engineering and technologyPolyethylene Glycol030226 pharmacology & pharmacyPolyethylene GlycolsBenzodiazepines03 medical and health sciences0302 clinical medicineDifferential scanning calorimetrymedicineParticle SizePyrrolidinoneSolubilityFourier transform infrared spectroscopyPolymerPolyvinylDissolutionPharmaceutical filmBenzodiazepineChromatographyCrystallineChemistryHydrogen BondingPoloxamer021001 nanoscience & nanotechnologyPyrrolidinonesDrug LiberationMicrocrystallineSolubilityChemical engineeringOlanzapinePoloxamer 407PolyvinylsParticle sizeCrystallization0210 nano-technologymedicine.drugInternational Journal of Pharmaceutics
researchProduct

Brivaracetam as add-on treatment in patients with post-stroke epilepsy: real-world data from the BRIVAracetam add-on First Italian netwoRk Study (BRI…

2022

Objective: Post-stroke epilepsy (PSE) is one of the most common causes of acquired epilepsy and accounts for about 10-15% of all newly diagnosed epilepsy cases. However, evidence about the clinical profile of antiseizure medications in the PSE setting is currently limited. Brivaracetam (BRV) is a rationally developed compound characterized by high-affinity binding to synaptic vesicle protein 2A. The aim of this study was to assess the 12-month effectiveness and tolerability of adjunctive BRV in patients with PSE treated in a real-world setting. Methods: This was a subgroup analysis of patients with PSE included in the BRIVAracetam add-on First Italian netwoRk Study (BRIVAFIRST). The BRIVAFI…

AdultAntiseizure medication; Brivaracetam; Cerebrovascular diseases; Focal seizures; StrokeCerebrovascular diseasesSettore MED/26Antiseizure medication Brivaracetam Focal seizures Stroke Cerebrovascular diseasesFocal seizuresDouble-Blind MethodDrug TherapySeizuresHumansAgedRetrospective StudiesAntiseizure medicationEpilepsyGeneral MedicineMiddle AgedPyrrolidinonesStrokeTreatment OutcomeNeurologyItalyCombinationBrivaracetamAntiseizure medication; Brivaracetam; Cerebrovascular diseases; Focal seizures; Stroke; Adult; Aged; Anticonvulsants; Double-Blind Method; Drug Therapy Combination; Humans; Italy; Middle Aged; Pyrrolidinones; Retrospective Studies; Seizures; Treatment Outcome; Epilepsy; StrokeDrug Therapy CombinationAnticonvulsantsNeurology (clinical)
researchProduct

Sustained seizure freedom with adjunctive brivaracetam in patients with focal onset seizures

2022

The maintenance of seizure control over time is a clinical priority in patients with epilepsy. The aim of this study was to assess the sustained seizure frequency reduction with adjunctive brivaracetam (BRV) in real-world practice. Patients with focal epilepsy prescribed add-on BRV were identified. Study outcomes included sustained seizure freedom and sustained seizure response, defined as a 100% and a ≥50% reduction in baseline seizure frequency that continued without interruption and without BRV withdrawal through the 12-month follow-up. Nine hundred ninety-four patients with a median age of 45 (interquartile range = 32-56) years were included. During the 1-year study period, sustained se…

AdultFreedomfocal seizuresEpilepsiesSettore MED/26Double-Blind MethodDrug Therapyantiseizure medication; brivaracetam; focal seizures; seizure freedom; sodium channel blockers; Adult; Double-Blind Method; Drug Therapy Combination; Freedom; Humans; Middle Aged; Pyrrolidinones; Seizures; Treatment Outcome; Anticonvulsants; Epilepsies PartialSeizuresseizure freedomHumansanti-seizure medication; focal seizures; epilepsyantiseizure medicationbrivaracetamanti-seizure medicationMiddle AgedPyrrolidinonesTreatment OutcomeNeurologysodium channel blockersCombinationepilepsyDrug Therapy CombinationAnticonvulsantsNeurology (clinical)Epilepsies PartialPartial
researchProduct

Correction to: Adjunctive Brivaracetam in Focal Epilepsy: Real‑World Evidence from the BRIVAracetam add‑on First Italian netwoRk Study (BRIVAFIRST)

2021

In randomized controlled trials, add-on brivaracetam (BRV) reduced seizure frequency in patients with drug-resistant focal epilepsy. Studies performed in a naturalistic setting are a useful complement to characterize the drug profile.This multicentre study assessed the effectiveness and tolerability of adjunctive BRV in a large population of patients with focal epilepsy in the context of real-world clinical practice.The BRIVAFIRST (BRIVAracetam add-on First Italian netwoRk STudy) was a retrospective, multicentre study including adult patients prescribed adjunctive BRV. Patients with focal epilepsy and 12-month follow-up were considered. Main outcomes included the rates of seizure-freedom, s…

AdultMaleDrug Resistant EpilepsyLevetiracetamEpilepsy CNS therapyCorrectionMiddle AgedSettore MED/26PyrrolidinonesPsychiatry and Mental healthTreatment OutcomeItalyChemotherapy AdjuvantHumansPharmacology (medical)AnticonvulsantsFemaleNeurology (clinical)Epilepsies PartialRetrospective Studies
researchProduct

Effects of antiepileptic drugs on cortical excitability in humans: A TMS-EMG and TMS-EEG study.

2018

Brain responses to transcranial magnetic stimulation (TMS) recorded by electroencephalography (EEG) are emergent noninvasive markers of neuronal excitability and effective connectivity in humans. However, the underlying physiology of these TMS-evoked EEG potentials (TEPs) is still heavily underexplored, impeding a broad application of TEPs to study pathology in neuropsychiatric disorders. Here we tested the effects of a single oral dose of three antiepileptic drugs with specific modes of action (carbamazepine, a voltage-gated sodium channel (VGSC) blocker; brivaracetam, a ligand to the presynaptic vesicle protein VSA2; tiagabine, a gamma-aminobutyric acid (GABA) reuptake inhibitor) on TEP a…

AdultMaleTiagabinemedicine.medical_treatmentElectroencephalographyBrivaracetam050105 experimental psychology03 medical and health scienceschemistry.chemical_compoundYoung Adult0302 clinical medicineDouble-Blind MethodMedicineHumans0501 psychology and cognitive sciencesRadiology Nuclear Medicine and imagingNeurotransmitterTiagabineEvoked PotentialsResearch ArticlesCerebral CortexN100Cross-Over StudiesRadiological and Ultrasound Technologymedicine.diagnostic_testbusiness.industryElectromyography05 social sciencesElectroencephalographyCarbamazepineTranscranial Magnetic StimulationHealthy VolunteersPyrrolidinonesTranscranial magnetic stimulationCarbamazepineNeurologychemistryAnticonvulsantsNeurology (clinical)AnatomybusinessReuptake inhibitorNeuroscience030217 neurology & neurosurgerymedicine.drugHuman brain mapping
researchProduct

Investigation into the role of phosphodiesterase IV in bronchorelaxation, including studies with human bronchus.

1993

1. We have investigated the role of cyclic nucleotide phosphodiesterase IV (PDE IV) in the relaxation of human bronchus and guinea-pig trachea in vitro and in guinea-pigs in vivo. 2. Functional studies showed that the selective PDE IV inhibitors, rolipram and denbufylline, relaxed human and guinea-pig preparations in vitro. 3. Two clinically used xanthine non-selective PDE inhibitors, theophylline and pentoxifylline, were also effective in these preparations, but were much less potent than the selective agents used. 4. The rank order of potency for the four PDE inhibitors in both species was similar. 5. Biochemical studies indicated that PDE IV was the major PDE isoform present in the human…

AdultMalemedicine.medical_specialtyPhosphodiesterase InhibitorsGuinea PigsBiologyIn Vitro TechniquesPentoxifyllinechemistry.chemical_compoundTheophyllineIn vivoInternal medicinemedicineAnimalsHumansTheophyllineheterocyclic compoundsPentoxifyllineRolipramAgedPharmacologyCyclic nucleotide phosphodiesterasePhosphoric Diester HydrolasesIsoproterenolMiddle AgedXanthinemusculoskeletal systemAsthmaPyrrolidinonesBronchodilator AgentsCyclic Nucleotide Phosphodiesterases Type 4IsoenzymesBronchodilatationenzymes and coenzymes (carbohydrates)Disease Models AnimalEndocrinologychemistryEnzyme inhibitor3'5'-Cyclic-AMP PhosphodiesterasesXanthinesbiology.proteinFemalesense organsRoliprammedicine.drugcirculatory and respiratory physiologyResearch Article
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Adjunctive Brivaracetam in Older Patients with Focal Seizures: Evidence from the BRIVAracetam add‑on First Italian netwoRk Study (BRIVAFIRST).

2022

BACKGROUND: The management of epilepsy in older adults has become part of daily practice because of an aging population. Older patients with epilepsy represent a distinct and more vulnerable clinical group as compared with younger patients, and they are generally under-represented in randomized placebo-controlled trials. Real-world studies can therefore be a useful complement to characterize the drug's profile. Brivaracetam is a rationally developed compound characterized by high-affinity binding to synaptic vesicle protein 2A and approved as adjunctive therapy for focal seizures in adults with epilepsy. OBJECTIVE: The aim of this study was to assess the 12-month effectiveness and tolerabil…

Antiseizure medicationEpilepsySettore MED/26PyrrolidinonesFocal seizuresTreatment OutcomeDrug TherapyDouble-Blind MethodItalySeizuresBrivaracetamCombinationAntiseizure medication; Brivaracetam; Focal seizuresAged; Double-Blind Method; Drug Therapy Combination; Humans; Italy; Pyrrolidinones; Retrospective Studies; Seizures; Treatment Outcome; Anticonvulsants; EpilepsyHumansPharmacology (medical)Settore MED/26 - NeurologiaAnticonvulsantsDrug Therapy CombinationGeriatrics and GerontologyAgedRetrospective StudiesDrugsaging
researchProduct