Search results for "RAM"

showing 10 items of 35643 documents

Comparison of degrees of maturity of rabbit lines selected for different traits

2015

[EN] The aim of this work was to study whether commercial nucleus lines of rabbits selected for different traits, and experimental lines having commercial purposes, have the same degree of maturity when compared at the same slaughter age. The study was carried out with 17897 rabbits from Universitat Politècnica de València. Rabbits came from the maternal lines A (3902 rabbits; 44th generation), V (4238 rabbits; 39th generation) and LP (6115 rabbits; 9th generation), selected for litter size at weaning; the paternal line R (2023 rabbits; 25th generation), selected for growth rate between 28 and 63 days of age; the maternal line OR (586 rabbits; 11th generation) selected for ovulation rate; a…

lcsh:Veterinary medicineMaturity degreeRabbitBiologyAnimal scienceAdult weightWeaninglcsh:SF600-1100Animal Science and ZoologyIntramuscular fatlcsh:Animal cultureSlaughter ageSelectionlcsh:SF1-1100
researchProduct

New Insights into the complexation of lead(II) by 1,4,7,10-tetrakis(carbamoylmethyl)-1,4,7,10-tetraazacyclododecane (DOTAM): structural, thermodynami…

2007

The lead(II) coordination properties of the tetrapodal ligand DOTAM [1,4,7,10-tetrakis(carbamoylmethyl)-1,4,7,10-tetraaza-cyclododecane] have been investigated both in the solid state and in solution in order to ascertain the stereoactivity of the lone pair and to rationalize the structural effects of a cyclen-based scaffold on the metal uptake kinetics. The crystal structure of the free base shows that the pendant acetamide groups are not equivalent: two are folded over the macrocycle and maintained by an intramolecular hydrogen bond involving an amide hydrogen atom and a neighboring tertiary amine of the cyclen ring, while the other two are extended and point away from the macrocyclic cav…

leadCoordination sphereTertiary amine010405 organic chemistryChemistryHydrogen bondLigandStereochemistry[ CHIM.COOR ] Chemical Sciences/Coordination chemistry010402 general chemistry01 natural sciences0104 chemical sciences[CHIM.THEO]Chemical Sciences/Theoretical and/or physical chemistryInorganic Chemistrychemistry.chemical_compoundCrystallographyCyclenAmideIntramolecular force[ CHIM.THEO ] Chemical Sciences/Theoretical and/or physical chemistry[CHIM.COOR]Chemical Sciences/Coordination chemistryLone pairDOTAMComputingMilieux_MISCELLANEOUS
researchProduct

The Effect of Dopants on Sintering and Microstructure of Lead-free KNN Ceramics

2011

Lead-free potassium sodium niobate (K0.5Na0.5)NbO3 (KNN) has been prepared via conventional ceramic processing method. The influence of 0.5 wt% - 1.5 wt% MnO2 and WO3 addition on the sintering, crystallographic structure, microstructure and dielectric properties of KNN has been investigated. Optimal sintering temperatures of KNN ceramics were observed to be in the narrow interval: 1090 °C - 1110 °C for MnO2 doped KNN; 1150 °C - 1170 °C for pure KNN and doped with WO3. XRD patterns showed that all the samples have single perovskite structure with monoclinic structure. Microstructure of ceramics was changed greatly by using dopants.http://dx.doi.org/10.5755/j01.ms.17.1.251

lead-freelcsh:TN1-997sinteringMaterials scienceDopantDopingAnalytical chemistrySinteringMineralogyDielectricCrystal structureMicrostructurepotassium sodium niobatevisual_artpiezoelectric ceramicsvisual_art.visual_art_mediumoxide additivesGeneral Materials ScienceCeramiclcsh:Mining engineering. MetallurgyMonoclinic crystal systemMedžiagotyra
researchProduct

Improving quality and safety in nursing homes and home care: the study protocol of a mixed-methods research design to implement a leadership interven…

2018

IntroductionNursing homes and home care face challenges across different countries as people are living longer, often with chronic conditions. There is a lack of knowledge regarding implementation and impact of quality and safety interventions as most research evidence so far is generated in hospitals. Additionally, there is a lack of effective leadership tools for quality and safety improvement work in this context.Methods and analysisThe aim of the ‘Improving Quality and Safety in Primary Care—Implementing a Leadership Intervention in Nursing Homes and Homecare’ (SAFE-LEAD) study is to develop and evaluate a research-based leadership guide for managers to increase quality and safety compe…

leadershipAttitude of Health PersonneleducationPsychological interventionGuidelines as TopicNorwegiannursing homescontextprimary care03 medical and health sciencesPatient safety0302 clinical medicineNursingSurveys and QuestionnairesProtocolpatient safetyHumansMedicineSocial media15061704030212 general & internal medicineCompetence (human resources)interventionNetherlandspasientsikkerhetNorway:Medical disciplines: 700::Clinical medical disciplines: 750::Geriatrics: 778 [VDP]business.industry030503 health policy & servicesMultimethodologyaldershjemGeneral MedicineHome Care ServicesQuality Improvementlanguage.human_languageNursing HomesPeer reviewsykehjemResearch DesignqualitylanguageHealth Services Research0305 other medical scienceNursing homesbusinessProgram EvaluationBMJ Open
researchProduct

A Framework of Professional Transferable Competences for System Innovation: Enabling Leadership and Agency for Sustainable Development

2021

System Innovation (SI) is a critical approach in driving individual and collective actions towards sustainable development (SD). This article presents the validation process of the Climate-KIC Professional Competence Framework (CF) for SI. This framework is based on principles of system thinking and the need for human capital to deal with challenges related to long-term sustainability. It comprises twenty competences grouped into five stages that describe contexts where professionals implement transformations: Exploring, Framing, Designing, Implementing and Strengthening. The stages are not linear or strictly sequential because overlapping and loops are frequent in transformational and disr…

leadershipcompetence frameworkProcess managementGeography Planning and DevelopmentTJ807-830CertificationManagement Monitoring Policy and LawTD194-195Human capitalRenewable energy sourcesAgency (sociology)Systems thinkinghuman capitalGE1-350disruptiveSustainable developmentsustainable developmentsystem thinkingEnvironmental effects of industries and plantsRenewable Energy Sustainability and the Environmentprofessional transferable competencesEnvironmental sciencesTransformational leadershipSustainabilityBusinesssystem innovationSocial capitaltransformationalSustainability
researchProduct

Identity and relationship frames in medical leadership communication

2021

PurposeA frame is an interpretive scheme of meanings that guide participants’ interpretations of social interaction and their actions in social situations (Goffman, 1974). By identifying early-career physicians’ identity and relationship frames, this study aims to produce information about socially constructed ways to interpret leadership communication in a medical context.Design/methodology/approachThe data consist of essays written by young physicians (n= 225) during their specialization training and workplace learning period. The analysis was conducted applying constructive grounded theory.FindingsThree identity and relationship frames were identified: the expertise frame, the collegial …

leadershipframeleadership communicationIdentity (social science)Constructivehenkilöstöjohtaminenhuman resource managementPhysiciansterveysalaHumansFrame (artificial intelligence)identiteettilääkäritWorkplacesisäinen viestintäidentityjohtajuusviestintäleader-follower relationshipphysiciancommunicationCommunicationesimies-alaissuhdemedical leadershipleader-follower interactionSocial constructionismSocial relationLeadershipLeadership studiesHuman resource managementPsychologySocial psychologyPeriod (music)Leadership in Health Services
researchProduct

Investigating the direct and indirect effects of a school-based leadership program for primary school students: Rationale and study protocol for the …

2023

Background Leadership is a valuable skill that can be taught in school, and which may have benefits within and beyond the classroom. Learning to Lead (L2L) is a student-led, primary school-based leadership program whereby older ‘peer leaders’ deliver a fundamental movement skills (FMS) program to younger ‘peers’ within their own school. Aim The aims of the study are to determine the efficacy of a peer-led FMS intervention on: (i) peer leaders’ (aged 10 to 12 years) leadership effectiveness (primary outcome), leadership self-efficacy, well-being, and time on-task in the classroom; (ii) peers’ (aged 8 to 10 years) physical activity levels, actual and perceived FMS competency, cardiorespirato…

leadershipvertaistukiMultidisciplinaryschool-based leadership programtuloksellisuusvertaisjohtamineneffectivenesskoululaisetlapset (ikäryhmät)peer leadersprimary school studentsfyysinen kuntofundamental movement skillsfyysinen aktiivisuusjohtajuusinterventiovertaissuhteetPLOS ONE
researchProduct

"If I don’t enjoy it, how are my kids going to enjoy it?" : case study in English grammar teaching

2015

The question over how grammar should be taught has been discussed amongst s everal linguistics scholars. Different grammar teaching methods present different focus on the target language, grammar and learner’s role. All of the methods have their strengths and weaknesses and in order to know which method to pick, one must know all the strengths and weaknesses of these methods. In this case study, a teacher from Central Finland was interviewed on her grammar teaching methods and the reasons behind these methods for fifth-graders. Factors influencing her selection of methods were the grammatical topic to be taught, learners’ different learning styles, relevance of the topic and the most natura…

learner- centeredTheoryofComputation_MATHEMATICALLOGICANDFORMALLANGUAGESComputingMilieux_COMPUTERSANDEDUCATIONstrengths and weaknessesgrammar teaching methods
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Interpretazione cognitiva, interpretazione decisoria, interpretazione creativa

2013

The article critically reviews Riccardo Guastini’s theory of legal interpretation, as it is now exposed in the recent book Interpretare e argomentare. While broadly sympathetic with Guastini’s jurisprudential project, the author tries to highlight some weaknesses in his conceptual framework – namely, regarding the distinction between “scientific” and “decisional” interpretation, the distinction between interpretation properly understood and creation of new law, and the concept of interpretive creativity

legal interpretation framework of possible meanings acknowledging existing law vs creating new lawSettore IUS/20 - Filosofia Del Diritto
researchProduct