Search results for "RAM"

showing 10 items of 35643 documents

Optical study of gallium and nitrogen polarity layers of GaN grown on sapphire

2003

A confocal Raman spectroscopic study was carried out on either side of an intentionally grown GaN inversion domain boundary between a pair of strips with opposite (Ga- or N-) polarity. It is shown that the Raman spectra on the N-polarity side displays an A1(TO) mode, prohibited by symmetry considerations, meanwhile on Ga-polarity material this peak is absent, indicating a lower density of defects present in this region. The Raman spectra reveal that in the lateral direction, the change in structural quality accross the inversion domain boundary is rather continuous and extends along 4 ± 1 μm. (© 2003 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim)

symbols.namesakechemistrylawConfocalAnalytical chemistrysymbolsSapphirechemistry.chemical_elementSTRIPSGalliumRaman spectroscopyNitrogenlaw.inventionphysica status solidi (c)
researchProduct

Appendix: Feynman rules

2010

symbols.namesakemedicine.anatomical_structureCalculussymbolsmedicineFeynman diagramAppendixMathematicsThe Pinch Technique and its Applications to Non-Abelian Gauge Theories
researchProduct

Hadronic light-by-light contribution to $(g-2)_\mu$ from lattice QCD with SU(3) flavor symmetry

2020

We perform a lattice QCD calculation of the hadronic light-by-light contribution to $(g-2)_\mu$ at the SU(3) flavor-symmetric point $m_\pi=m_K\simeq 420\,$MeV. The representation used is based on coordinate-space perturbation theory, with all QED elements of the relevant Feynman diagrams implemented in continuum, infinite Euclidean space. As a consequence, the effect of using finite lattices to evaluate the QCD four-point function of the electromagnetic current is exponentially suppressed. Thanks to the SU(3)-flavor symmetry, only two topologies of diagrams contribute, the fully connected and the leading disconnected. We show the equivalence in the continuum limit of two methods of computin…

symmetry: flavorParticle physicstopologymagnetic momentPhysics and Astronomy (miscellaneous)Feynman graphHigh Energy Physics::LatticeLattice field theoryHadronExtrapolationhep-lat01 natural sciencesspace: Euclideansymbols.namesakePionHigh Energy Physics - LatticeLattice (order)quantum chromodynamics0103 physical sciencesquantum electrodynamicsFeynman diagramcontinuum limit010306 general physicsEngineering (miscellaneous)perturbation theorylatticeParticle Physics - PhenomenologyQuantum chromodynamicsPhysicsform factor: transitioncurrent: electromagneticfinite size: effect[PHYS.HLAT]Physics [physics]/High Energy Physics - Lattice [hep-lat]010308 nuclear & particles physicslattice field theoryphoton photon: scatteringhep-phParticle Physics - LatticeLattice QCDsuppressionHigh Energy Physics - Phenomenology[PHYS.HPHE]Physics [physics]/High Energy Physics - Phenomenology [hep-ph]symbolsflavor: SU(3)n-point function: 4
researchProduct

CCDC 846271: Experimental Crystal Structure Determination

2012

Related Article: G.Callebaut, S.Mangelinckx, L.Kiss, R.Sillanpaa, F.Fulop, N.De Kimpe|2012|Org.Biomol.Chem.|10|2326|doi:10.1039/c2ob06637h

syn-Ethyl 4-chloro-N-(diphenylmethylene)-3-(((4-methylphenyl)sulfinyl)amino)leucinateSpace GroupCrystallographyCrystal SystemCrystal StructureCell ParametersExperimental 3D Coordinates
researchProduct

A comparison of different synchronization measures in electroencephalogram during propofol anesthesia

2016

Electroencephalogram (EEG) synchronization is becoming an essential tool to describe neurophysiological mechanisms of communication between brain regions under general anesthesia. Different synchronization measures have their own properties to reflect the changes of EEG activities during different anesthetic states. However, the performance characteristics and the relations of different synchronization measures in evaluating synchronization changes during propofol-induced anesthesia are not fully elucidated. Two-channel EEG data from seven volunteers who had undergone a brief standardized propofol anesthesia were then adopted to calculate eight synchronization indexes. We computed the predi…

synchronization measurespropofol anesthesianeurophysiological mechanismselectroencephalogramloss of consciousness
researchProduct

An Easy Route Towards Regioselectively Difunctionalized Cyclens and New Cryptands.

2006

Reductive amination of various aldehydes with cyclen represents a very convenient method for the synthesis of a wide range of 1,7-difunctionalized cyclens, as well as new cryptands.

synthesisStereochemistry[CHIM.ORGA]Chemical Sciences/Organic chemistry010405 organic chemistryCryptandMetals and AlloysGeneral ChemistryGeneral Medicine010402 general chemistry01 natural sciencesCombinatorial chemistryReductive aminationCatalysisSurfaces Coatings and FilmsElectronic Optical and Magnetic Materialscyclen0104 chemical sciences3. Good healthchemistry.chemical_compoundCyclenchemistry[ CHIM.ORGA ] Chemical Sciences/Organic chemistryMaterials ChemistryCeramics and CompositesComputingMilieux_MISCELLANEOUSChemInform
researchProduct

Lack of Good Governance or hazard of consumers e-Health? Evidence through a dynamic outcome based-performance in the Italian healthcare sector about …

This research aims to analyse the management of the health policies to contain the measles outbreaks in Italy. In particular, this study wants to find out what are the key factors that led to the measles outbreak of 2017 and its previous cyclical trend, analysing the impact of ehealth strategy in the management of the epidemics. Understanding the complexity of this issue will help to evaluate the actual policies of the Italian Ministry of Healthcare and to steer the policy-makers to frame sustainable policies to manage the risk of a measles outbreak. The thesis is structured in four chapters. The first chapter, through a literature review, discusses the evolution of the management of epidem…

system dynamicmodellingSettore SECS-P/07 - Economia Aziendalecasual loop diagrampublic management public administrationdynamic performance managementmeaslehealthcarestock and flow diagramvaccination
researchProduct

The use of cryptograms with arithmetic operations in school teaching

2013

The text presents a method of solving cryptograms with arithmetic operations. This method is based on systems of equations. In the case of cryptograms with adding and subtracting operations we have to solve systems of linear equations while in the case of cryptograms with multiplying and dividing operations we have to solve systems of non-linear equations. The method of deciphering cryptograms will be illustrated by examples.

systems of non-linear equationscryptogramssystems of linear equationsUsta ad Albim Bohemica
researchProduct

Gauge theory phase diagrams from holography

2014

säieteoriaduaaliteoriaydinreaktiotneutronitähdetraskasionitörmäyksetkvarkittiheysfaasidiagrammilämpötilafaasitGauge/gravity dualitiesydinainehiukkasfysikka
researchProduct

Brunissage, polissage et degrés de séchage : un référentiel expérimental

2010

As a great many technical operations are involved in the creation of pottery, it is often difficult to discover precisely in what order they were used in the "chaînes opératoires". The determination of the state of drying is an essential step in rediscovering the archaeological chaîne opératoire. An experimental method is developed to identify burnishing and polishing techniques. The states of drying can be identified by the study of experimental trace types and surface aspects. Precise differenciation on archaeological sherds between burnishing and polishing techniques then becomes possible. The development of this method for other techniques will undoubtedly increase the quality and preci…

séchagecéramologie[SHS.ARCHEO] Humanities and Social Sciences/Archaeology and PrehistoryArchéologie[SHS.ARCHEO]Humanities and Social Sciences/Archaeology and Prehistory[ SHS.ARCHEO ] Humanities and Social Sciences/Archaeology and Prehistorypolissagebrunissageexpérimentation
researchProduct