Search results for "RAV"

showing 10 items of 5866 documents

Gauge / gravity dualities

2009

säieteoriamittakenttäteoriagravitaatiohiukkasfysiikkaholografia
researchProduct

Supersymmetry, supergravity and the AdS/CFT correspondence

2011

Tämä tutkielma on johdatus AdS/CFT-dualiteettiin. Pääasiallinen tavoitteeni on ollut ymmärtää se ajatusten ketju, joka alkaa tavallisesta kvanttikenttäteoriasta ja yleisestä suhteellisuusteoriasta ja päätyy konjektuuriin, jonka mukaan tietyt säieteoriat ovat ekvivalentteja alempiulotteisten mittateorioiden kanssa. Dualiteetin sovellukset mallien rakentamisessa jäävät tässä työssä vähälle huomiolle. Kappale 1 sisältää katsauksen supersymmetriaan. Lyhyen historiallisen johdatuksen jälkeen esittelemme supersymmetriamuunnosten algebran. Tämän algebran esityksiä tutkimme sekä abstraktein menetelmin että tarkastelemalla esimerkkiä supersymmetrisestä kenttäteoriasta. Tämän jälkeen esittelemme supe…

säieteoriasupersymmetriaAdS/CFTgravitaatio
researchProduct

Numerical Recovery of Source Singularities via the Radiative Transfer Equation with Partial Data

2013

The inverse source problem for the radiative transfer equation is considered, with partial data. Here we demonstrate numerical computation of the normal operator $X_{V}^{*}X_{V}$ where $X_{V}$ is the partial data solution operator to the radiative transfer equation. The numerical scheme is based in part on a forward solver designed by F. Monard and G. Bal. We will see that one can detect quite well the visible singularities of an internal optical source $f$ for generic anisotropic $k$ and $\sigma$, with or without noise added to the accessible data $X_{V}f$. In particular, we use a truncated Neumann series to estimate $X_{V}$ and $X_{V}^{*}$, which provides a good approximation of $X_{V}^{*…

ta113Applied MathematicsGeneral MathematicsOperator (physics)ta111010102 general mathematicsMathematical analysisMicrolocal analysisNumerical Analysis (math.NA)Inverse problem01 natural sciences35R30 (Primary) 35S05 35R09 35Q20 92C55Neumann series010101 applied mathematicsSobolev spaceMathematics - Analysis of PDEsRadiative transferFOS: MathematicsGravitational singularityMathematics - Numerical Analysis0101 mathematicsAnisotropyMathematicsAnalysis of PDEs (math.AP)
researchProduct

One-pot synthesis and characterization of subnanometre-size benzotriazolate protected copper clusters

2012

A simple one-pot method for the preparation of subnanometre-size benzotriazolate (BTA) protected copper clusters, Cu(n)BTA(m), is reported. The clusters were analyzed by optical and infrared spectroscopy, mass spectrometry and transmission electron microscopy together with computational methods. We suggest a structural motif where the copper core of the Cu(n)BTA(m) clusters is protected by BTA-Cu(i)-BTA units.

ta114Inorganic chemistryOne-pot synthesischemistry.chemical_elementInfrared spectroscopyTriazolesMass spectrometryCopperCharacterization (materials science)CrystallographychemistryCoordination ComplexesTransmission electron microscopyQuantum TheorySpectrophotometry UltravioletGeneral Materials ScienceStructural motifta116CopperNanoscale
researchProduct

Tidal Gravity Observations at Mt. Etna and Stromboli: results concerning the modeled and observed tidal factors

2006

tadial factors gravity volcanomonitoring
researchProduct

An Atypical Case of Taravana Syndrome in a Breath-Hold Underwater Fishing Champion: A Case Report

2013

Dysbaric accidents are usually referred to compressed air-supplied diving. Nonetheless, some cases of decompression illness are known to have occurred among breath-hold (BH) divers also, and they are reported in the medical literature. A male BH diver (57 years old), underwater fishing champion, presented neurological disorders as dizziness, sensory numbness, blurred vision, and left frontoparietal pain after many dives to a 30–35 meters sea water depth with short surface intervals. Symptoms spontaneously regressed and the patient came back home. The following morning, pain and neurological impairment occurred again and the diver went by himself to the hospital where he had a generalized to…

taravana syndrome DCImedicine.medical_specialtymedicine.diagnostic_testbusiness.industrylcsh:RChampionSettore MED/41 - AnestesiologiaPoison controlInfarctionlcsh:MedicineCase ReportDecompression illnessGeneral Medicinemedicine.diseaseSurgeryTaravanaBlurred visionAnesthesiaMagnetic resonance imaging of the brainMedicineNeurological findingsmedicine.symptombusinesshuman activitiesCase Reports in Medicine
researchProduct

Ultraviolet B radiation induced alterations in immune function of fish : in relation to habitat preference and disease resistance

2009

Runsas altistuminen auringolle on tunnetusti haitallista ihmisten ja eläinten hyvinvoinnille. Eveliina Markkula tutki väitöskirjatyössään, miten ultravioletti B (UVB) -säteilylle altistuminen vaikuttaa kalojen vastustuskykyyn ja tautialttiuteen.- Ilmakehän otsonikerroksen oheneminen viime vuosikymmenten aikana on johtanut UVB-säteilyn lisääntymiseen maan pinnalla. UVB-säteily tunkeutuu myös kirkkaisiin järvi- ja merivesiin ja voi näin aiheuttaa haittaa kaloille, Markkula kertoo.UVB-säteilyn on jo aiemmin todettu lisäävän kalojen varhaisten elinvaiheiden epämuodostumia ja kuolleisuutta. Kertaluonteinenkin altistuminen lampuilla tuotetulle UVB-säteilylle aiheuttaa muutoksia kalan immuunijärje…

taudinkestävyysstress reactionsultraviolet radiationdisease resistanceOncohynchus mykissbenthic carpvaikutuksetkarppirainbow troutresistenssiimmune systemCyprinus carpiokirjolohiimmuunijärjestelmästressireaktiotultraviolettisäteilyphotobiologyUVBimmune functionkalat
researchProduct

CCTVCV: Computer Vision model/dataset supporting CCTV forensics and privacy applications

2022

The increased, widespread, unwarranted, and unaccountable use of Closed-Circuit TeleVision (CCTV) cameras globally has raised concerns about privacy risks for the last several decades. Recent technological advances implemented in CCTV cameras, such as Artificial Intelligence (AI)-based facial recognition and Internet of Things (IoT) connectivity, fuel further concerns among privacy advocates. Machine learning and computer vision automated solutions may prove necessary and efficient to assist CCTV forensics of various types. In this paper, we introduce and release the first and only computer vision models are compatible with Microsoft common object in context (MS COCO) and capable of accurately…

tekninen rikostutkintasovellukset (soveltaminen)datasetsobject detectiontekoälyprivacykameratcomputer visiontietosuojamachine learningkoneoppiminencamerasyksityisyyskameravalvontavideo surveillancekonenäköCCTVmappingkasvontunnistus (tietotekniikka)2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

CCTV-FullyAware: toward end-to-end feasible privacy-enhancing and CCTV forensics applications

2022

It is estimated that over 1 billion Closed-Circuit Television (CCTV) cameras are operational worldwide. The advertised main benefits of CCTV cameras have always been the same; physical security, safety, and crime deterrence. The current scale and rate of deployment of CCTV cameras bring additional research and technical challenges for CCTV forensics as well, as for privacy enhancements. This paper presents the first end-to-end system for CCTV forensics and feasible privacy-enhancing applications such as exposure measurement, CCTV route recovery, CCTV-aware routing/navigation, and crowd-sourcing. For this, we developed and evaluated four complex and distinct modules (CCTVCV [1], OSRM-CCTV [2],…

tekninen rikostutkintatietosuojamachine learningkoneoppiminenyksityisyyskameravalvontaobject detectionvideo surveillancekonenäkönavigationsovellusohjelmatyksilönsuojaprivacy-enhancing technologies2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

Can foliar-applied nutrients improve caraway (Carum carvi L.) seed oil composition?

2021

Caraway seeds contain between 0.5–7% essential oil, rich in monoterpenes that have a characteristic aroma and chemical properties. Caraway oil has several bioactive compounds that are of industrial importance, particularly for pharmaceutical and health care products. Carvone and limonene are the main terpenes present in caraway oil, which along with some unique fatty acids (i.e. petroselinic acid) determine caraway (Carum carvi L.) oil quality. Both terpenes are important raw materials for industrial applications and their concentration influences the price of caraway seed and oil, hence there is need for identifying management practices that may increase the concentration of these and othe…

terpeenitcarvonerasvahapotlimoneneluonnonaineetravinteetfatty acidseteeriset öljytmaustekasvitessential oillannoituskumina (laji)
researchProduct