Search results for "RH"

showing 10 items of 15584 documents

Tie tulevaisuuteen! : Down-lapsen kommunikaation kehityksen tukeminen integroidussa päiväkotiryhmässä

1999

viittominenDownin oireyhtymäintegraatiokommunikaation kehitysvarhaiskuntoutus
researchProduct

Puheterapian merkitys pienten dysfasialasten perheissä

1997

viivästynyt puheenkehitysvanhemmatdysfasiaerityisvaikeudetvarhaiskuntoutus
researchProduct

Non-abusing mothers' support needs after child sexual abuse disclosure : A narrative review

2018

The role of maternal support has been perceived as vital throughout the recovery process of sexually abused children. However, it is important to look at the concept “support” from the perspective of non‐abusing mothers' personal needs. This narrative review of the literature aimed to find out how non‐abusing mothers' need for support in their responses to disclosure of child sexual abuse has been recognized. A comprehensive search on Jyväskylä University Library interface yielded 12 academic articles based on empirical research. These articles were selected from those considered to have sufficiently investigated support for non‐abusing mothers and included a mixture of qualitative, quantit…

violenceperheväkivaltalähisuhdeväkivaltaväkivaltaseksuaalinen hyväksikäyttösosiaalinen tukiäitiysmothering
researchProduct

Filosofia, mediazione, violenza. L'utilità del vero per il linguaggio (da Nietzsche ai Greci)

2017

The essays starts from Nietzsche's analysis of ancient Rhetorics as pursued in his lecture courses and explores his notion of language as set of metaphors in order to outline two models of truth that can be traced back in greek thought: 1. "judiciary" truth as refutation of the opposite opinion and 2. truth as will to integrate the opposition into a non-violent form of knowledge and agreement.

violencetruthrhetoricplatoSettore M-FIL/06 - Storia Della Filosofianietzsche
researchProduct

Error messages in relational database management systems: A comparison of effectiveness, usefulness, and user confidence

2021

Abstract The database and the database management system (DBMS) are two of the main components of any information system. Structured Query Language (SQL) is the most popular query language for retrieving data from the database, as well as for many other data management tasks. During system development and maintenance, software developers use a considerable amount of time to interpret compiler error messages. The quality of these error messages has been demonstrated to affect software development effectiveness, and correctly formulating queries and fixing them when needed is an important task for many software developers. In this study, we set out to investigate how participants ( N = 152 ) …

virhetilanteetSQLError messageComputer scienceData managementStructured query language (SQL)CompilerQuery languagecomputer.software_genrekyselykieletDatabase management systemSet (abstract data type)SoftwareRelational database management systemInformation systemtietokannatcomputer.programming_languageSQLInformation retrievalbusiness.industrySoftware developmenthallintajärjestelmätHardware and ArchitecturevirheetohjelmistokehitysbusinesscomputerSoftwareInformation Systems
researchProduct

Measurement of dielectron production in central Pb-Pb collisions at √sNN = 2.76 TeV

2019

Published by the American Physical Society under the terms of the Creative Commons Attribution 4.0 International license. Further distribution of this work must maintain attribution to the author(s) and the published article's title, journal citation, and DOI. The first measurement of dielectron (e + e −) production in central (0 – 10 %) Pb – Pb collisions at √sNN=2.76TeV at the LHC is presented. The dielectron invariant-mass spectrum is compared to the expected contributions from hadron decays in the invariant-mass range 0 < mee < 3.5 GeV / c2. The ratio of data and the cocktail of hadronic contributions without vacuum ρ0 is measured in the invariant-mass range 0.15 < mee < 0.7 GeV / c2, w…

virtual [photon]:Kjerne- og elementærpartikkelfysikk: 431 [VDP]heavy ion collisionsHadrondielectron productionhiukkasfysiikkaPP01 natural sciencesS-W INTERACTIONSthermalALICEPhysics::Atomic PhysicsNuclear ExperimentBrookhaven RHIC CollPhysicsAU COLLISIONSLarge Hadron Colliderphoton: virtual ; photon: direct production ; heavy ion: scattering ; hadron: decay ; Brookhaven RHIC Coll ; transverse momentum ; CERN LHC Coll ; thermal ; ALICE ; mesonVDP::Kjerne- og elementærpartikkelfysikk: 431DIRECT PHOTON PRODUCTIONddc::Mathematics and natural scienses: 400::Physics: 430::Nuclear and elementary particle physics: 431 [VDP]PRIRODNE ZNANOSTI. Fizika.:Nuclear and elementary particle physics: 431 [VDP]CERN LHC CollVDP::Nuclear and elementary particle physics: 431Transverse momentumNuclear and High Energy PhysicsRho mesondirect production [photon]MesonPAIR PRODUCTIONPhoton lepton & quark productiontransverse momentumFew-body systemsmesonNuclear physicsDIRECT PHOTON PRODUCTION; S-W INTERACTIONS; AU COLLISIONS; RHO-MESON; DIMUON PRODUCTION; PAIR PRODUCTION; PP; J/PSI; ENHANCEMENT; EMISSIONENHANCEMENTscattering [heavy ion]0103 physical sciencesRelativistic heavy-ion collisionsRHO-MESON010306 general physicsParticle & resonance productionNuclear Physicsta114010308 nuclear & particles physics:Matematikk og naturvitenskap: 400::Fysikk: 430::Kjerne- og elementærpartikkelfysikk: 431 [VDP]NATURAL SCIENCES. Physics.J/PSIPair productionDIMUON PRODUCTIONQuark–gluon plasmaHigh Energy Physics::ExperimentEMISSIONdecay [hadron]
researchProduct

Arhīva virtuālo izstāžu izmantojamības novērtējums

2016

Pētījuma mērķis ir izpētīt Latvijas Nacionālā arhīva veidoto izstāžu izmantojamību. Bakalaura darba pētījumā pielietotās metodes: intervēšana un verbālā protokola metode. Pētījuma rezultātā izvirzītā hipotēze ir apstiprinājusies - Latvijas Nacionālā arhīva veidotās virtuālās izstādes ir kvalitatīvs un interaktīvs veids, kā tuvāk iepazīstināt un ieinteresēt lietotājus. Pētījuma rezultātā tika noskaidrots, ka arhīvs aktīvi popularizē un ar dažādiem veidiem cenšas piesaistīt jaunus lasītājus un interesentus savam krājumam, un izstādes ir viens no šiem veidiem. No izstāžu virtuālo apmeklētāju puses, kā arī lietojamības testēšanas rezultātā parādījās pavisam cita problēma – jaunākās paaudzes nev…

virtuālās izstādesizmantojamībalietojamībaarhīviBibliotēkzinātne
researchProduct

Transfection of lipoma cells with papilloma bovine virus subgenomic fragment.

1991

Abstract Lipoma cells with consistent chromosomal aberration have been transfected with plasmids carrying papilloma bovine virus subgenomic fragment (PBV 69). The succesful transformation of the cells was ascerted on the changed growth pattern of the cells in liquid medium, colony formation in soft agar and modified cell appearrance in electron microscopy; transfection with PBV 69 has not been, however, sufficient to immortalize lipoma cells.

virusesCellEndoplasmic ReticulumTransfectionVirusPlasmidotorhinolaryngologic diseasesmedicineTumor Cells CulturedHumansBovine papillomavirusSubgenomic mRNABovine papillomavirus 1Cell Line TransformedChromosome AberrationsbiologyMusclesCell DifferentiationCell BiologyTransfectionFibroblastsbiology.organism_classificationmedicine.diseaseCell Transformation ViralVirologyClone CellsMicroscopy Electronmedicine.anatomical_structureAdipose TissueCell culturePapillomaLipomaCell DivisionCell biology international reports
researchProduct

PTC124-mediated translational readthrough of a nonsense mutation causing Usher syndrome type 1C.

2011

We investigated the therapeutic potential of the premature termination codon (PTC) readthrough-inducing drug PTC124 in treating the retinal phenotype of Usher syndrome, caused by a nonsense mutation in the USH1C gene. Applications in cell culture, organotypic retina cultures, and mice in vivo revealed significant readthrough and the recovery of protein function. In comparison with other readthrough drugs, namely the clinically approved readthrough-inducing aminoglycoside gentamicin, PTC124 exhibits significant better retinal biocompatibility. Its high readthrough efficiency in combination with excellent biocompatibility makes PTC124 a promising therapeutic agent for PTCs in USH1C, as well a…

virusesUsher syndromeGenetic enhancementNonsense mutationGenetic VectorsCell Cycle ProteinsRetina03 medical and health scienceschemistry.chemical_compoundMice0302 clinical medicineIn vivootorhinolaryngologic diseasesGeneticsmedicineAnimalsHumansMolecular BiologyCells Cultured030304 developmental biologyAdaptor Proteins Signal TransducingGenetics0303 health sciencesOxadiazolesbusiness.industryfungiAminoglycosideTranslational readthroughmedicine.diseasePhenotype3. Good healthAtalurenMice Inbred C57BLCytoskeletal ProteinsLuminescent ProteinsElectroporationchemistryMicroscopy FluorescenceCodon NonsenseCancer researchMolecular MedicineGentamicinsbusinessUsher Syndromes030217 neurology & neurosurgeryHuman gene therapy
researchProduct

To See It All / To Hear It All: Michael Gira's Songs of Experience

2018

Between 2012 and 2016, the American experimental rock band Swans, led by the vocalist, multi-instrumentalist and visionary Michael Gira, released a monumental trilogy of albums comprising The Seer, To Be Kind, and The Glowing Man. The lyrics on all of them portray Gira’s own search for identity, with the result being a peculiar version of spirituality that is both philosophically religious and ideologically anti-religious. Forced to exist in the hostile, incomprehensible and spiritually-barren reality, the artist finds himself alienated in the state of the end of childhood and loss of innocence. In other words, he locates his identity in this final stage of spirituality and primal religion …

visionary poetryinnocence–experience dichotomyrhythmSwansWilliam Blakepost-ChristianityExplorations: A Journal of Language and Literature
researchProduct