Search results for "Rake"

showing 10 items of 866 documents

Aalto-1, multi-payload CubeSat: Design, integration and launch

2021

The design, integration, testing, and launch of the first Finnish satellite Aalto-1 is briefly presented in this paper. Aalto-1, a three-unit CubeSat, launched into Sun-synchronous polar orbit at an altitude of approximately 500 km, is operational since June 2017. It carries three experimental payloads: Aalto Spectral Imager (AaSI), Radiation Monitor (RADMON), and Electrostatic Plasma Brake (EPB). AaSI is a hyperspectral imager in visible and near-infrared (NIR) wavelength bands, RADMON is an energetic particle detector and EPB is a de-orbiting technology demonstration payload. The platform was designed to accommodate multiple payloads while ensuring sufficient data, power, radio, mechanica…

Computer sciencePolar orbitFOS: Physical sciencesAerospace Engineering02 engineering and technologyDesign strategy01 natural sciences7. Clean energyPhysics - Space Physicsmittauslaitteet0203 mechanical engineering0103 physical sciencesBrakeAalto-1CubeSatGround segmentAerospace engineeringInstrumentation and Methods for Astrophysics (astro-ph.IM)010303 astronomy & astrophysicsavaruustekniikkaAalto spectral imagerRadiation monitortutkimussatelliitit020301 aerospace & aeronauticsRadiationSpacecraftbusiness.industryPayloadCubeSatElectrostatic plasma brakesäteilySpace Physics (physics.space-ph)satelliititHyperspectralSatelliteAstrophysics - Instrumentation and Methods for Astrophysicsbusinesskosminen säteily
researchProduct

Perceived challenges in implementing ICT in career services

2018

Information and communication technology (ICT) has gradually gained a firm foothold within the field of guidance counselling. There is evidence of significant progress in integrating ICT into career services and related practices; however, the potential for further improvement persists. With the continuous proliferation of new technologies, improving the implementation of ICT in career services has become increasingly important. In this article Dr Jaana Kettunen outlines research from career development experts’ perspectives; providing important insights into the perceived challenges involved in the implementation of ICT in career services. nonPeerReviewed

ComputingMilieux_THECOMPUTINGPROFESSIONcareer servicesammatillinen kehitysICTtieto- ja viestintätekniikkaopastusinformation and communication technologyurakehitysohjaus (neuvominen)
researchProduct

Technological change and wage premiums: historical evidence from linked employer-employee data

2013

This study analyses the impacts of a technological change (the steam engine) on wage premiums. Using historical employer–employee panel data, we found that steam technology had both new skill-demanding and skill-replacing aspects. The former manifested itself as an increase in the demand for high-skilled engineers, the latter in a decline in the demand for intermediate-skilled, able-bodied seamen and an increase in the demand for unskilled engine room operators. Our panel data analysis, which controls for unobserved heterogeneity, implies that high-skilled labourers in abstract tasks and unskilled labourers in manual tasks improved their wage positions relative to intermediate-skilled labou…

ComputingMilieux_THECOMPUTINGPROFESSIONpalkkarakenneteknologiawage structure
researchProduct

A Bibliography on the Use of Communication and Information Technology in Counseling and Career Interventions

2020

This bibliography contains citations from publications or papers presented at professional meetings concerning the use of information and communication technology in the delivery of counseling and career interventions based on work completed at Florida State University and other organizations in various locations. Topics have evolved over time and include computer-assisted career guidance systems, career information delivery systems, assessment, information, distance counseling, social media, research and evaluation, ethical issues, and professional standards. The bibliography is organized by publication year and then author in reverse chronological order by date in order to highlight most …

ComputingMilieux_THECOMPUTINGPROFESSIONtieto- ja viestintätekniikkaohjaus (neuvonta ja opastus)bibliografiaturakehitys
researchProduct

Controlling thermal conductance using three-dimensional phononic crystals

2021

Controlling thermal transport at the nanoscale is vital for many applications. Previously, it has been shown that this control can be achieved with periodically nanostructured two-dimensional phononic crystals for the case of suspended devices. Here, we show that thermal conductance can also be controlled with three-dimensional phononic crystals, allowing the engineering of the thermal contact of more varied devices without the need for suspension in the future. We show the experimental results obtained at sub-Kelvin temperatures for two different period three-dimensional crystals and for a bulk control structure. The results show that the conductance can be enhanced with the phononic cryst…

Condensed Matter - Mesoscale and Nanoscale Physicsnanorakenteetlämmön johtuminenCondensed Matter::SuperconductivityPhysicsQC1-999Mesoscale and Nanoscale Physics (cond-mat.mes-hall)FOS: Physical scienceslämmön siirtyminenkiteetTP248.13-248.65fononitBiotechnologyAPL Materials
researchProduct

Real-space Wigner-Seitz Cells Imaging of Potassium on Graphite via Elastic Atomic Manipulation

2015

Atomic manipulation in the scanning tunnelling microscopy, conventionally a tool to build nanostructures one atom at a time, is here employed to enable the atomic-scale imaging of a model low-dimensional system. Specifically, we use low-temperature STM to investigate an ultra thin film (4 atomic layers) of potassium created by epitaxial growth on a graphite substrate. The STM images display an unexpected honeycomb feature, which corresponds to a real-space visualization of the Wigner-Seitz cells of the close-packed surface K atoms. Density functional simulations indicate that this behaviour arises from the elastic, tip-induced vertical manipulation of potassium atoms during imaging, i.e. el…

Condensed Matter::Quantum GasesCondensed Matter::Materials SciencenanorakenteetkaliumPhysics::Atomic and Molecular Clustersscanning tunnelling microscopyPhysics::Atomic Physics
researchProduct

Flat-band superconductivity in periodically strained graphene : mean-field and Berezinskii–Kosterlitz–Thouless transition

2020

In the search of high-temperature superconductivity one option is to focus on increasing the density of electronic states. Here we study both the normal and s-wave superconducting state properties of periodically strained graphene, which exhibits approximate flat bands with a high density of states, with the flatness tunable by the strain profile. We generalize earlier results regarding a one-dimensional harmonic strain to arbitrary periodic strain fields, and further extend the results by calculating the superfluid weight and the Berezinskii–Kosterlitz–Thouless (BKT) transition temperature T BKT to determine the true transition point. By numerically solving the self-consistency equation, w…

Condensed Matter::Quantum Gasesflat bandssuprajohtavuusnanorakenteetBCS theoryCondensed Matter::Superconductivitysuperconductivitygraphenestrain engineeringgrafeeni
researchProduct

Mass Measurements of Proton-rich Nuclei with JYFLTRAP

2011

The Penning trap setup JYFLTRAP, connected to the IGISOL facility, has been extensively used for atomic mass measurements of exotic nuclei. On the proton rich side of the chart of nuclei mass measurements have mostly contributed to fundamental physics and nuclear astrophysics studies with about 100 atomic masses measured. peerReviewed

Condensed Matter::Quantum Gasesnuclear spectroscopyydinrakennenuclear physicsaccelerator-based physicsNuclear Theorynuclear structurePhysics::Atomic and Molecular ClustersydinspektroskopiaPhysics::Atomic PhysicsNuclear Experimentydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Using change trajectories to study the impacts of multi-annual habitat loss on fledgling production in an old forest specialist bird

2017

The loss and subdivision of habitat into smaller and more spatially isolated units due to human actions has been shown to adversely affect species worldwide. We examined how changes in old forest cover during eight years were associated with the cumulative number of fledged offspring at the end of study period in Eurasian treecreepers (Certhia familiaris) in Central Finland. We were specifically interested in whether the initial level of old forest cover moderated this relation. We applied a flexible and powerful approach, latent growth curve modelling in a structural equation modeling (SEM) framework, to create trajectories describing changes in old forest cover through time, and studied h…

Conservation of Natural ResourcesScienceQRhabitathabitaattiBiodiversityForestsrakenneyhtälömallitArticlepuukiipijä (laji)TreesBirdsstructural equation modelsold growth forestsenvironmental changesvanhat metsätAnimalsHumansMedicinecommon treecreeperEcosystemFinlandympäristönmuutokset
researchProduct

Negotiating a transnational career around borders: Women's stories in boundaryless academia

2021

The study aimed to give voice to two women sport scientists' life stories to centralize the challenges and ways of coping their career journeys entailed, and enlighten our understanding of the lived experience and meaning of academic migrating. They shared transnational career stories through interviews and ongoing conversations which we re-story in a creative non-fiction story where we blended the two. Our data collection, analysis and representation were informed by theoretical, methodological and interpretive bricolage. As the creative non-fiction story shows, the academic entrepreneur ideal was somewhat disrupted in the women's lives, as migration experiences, aside from thrills, also i…

Coping (psychology)naisetmedia_common.quotation_subjectacademia050105 experimental psychologykansainvälinen liikkuvuusBricolage03 medical and health sciences0302 clinical medicineTransnationalismtransnationaalisuus0501 psychology and cognitive sciencesNarrativeMeaning (existential)työelämätransnational careerApplied Psychologymedia_commonsport scienceAside05 social sciencesProfessional developmentGender studies030229 sport sciencestutkijaturakehitysNegotiationliikuntatiedekokemuksetwomenPsychologynegotiating
researchProduct