Search results for "Ramipril"

showing 10 items of 30 documents

Cost-effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post hoc analysis of SMI…

2013

Claudio Borghi,1 Ettore Ambrosioni,1 Stefano Omboni,2 Arrigo FG Cicero,1 Stefano Bacchelli,1 Daniela Degli Esposti,1 Salvatore Novo,3 Dragos Vinereanu,4 Giuseppe Ambrosio,5 Giorgio Reggiardo,6 Dario Zava7 1Unit of Internal Medicine, Policlinico S Orsola, University of Bologna, Bologna, Italy; 2Italian Institute of Telemedicine, Varese, Italy; 3Division of Cardiology, University of Palermo, Palermo, Italy; 4University and Emergency Hospital, Bucharest, Romania; 5Division of Cardiology, University of Perugia, Perugia, Italy; 6Mediservice, Milano, Italy; 7Istituto Lusofarmaco d'Italia SpA, Peschiera Borromeo, Italy Background: In SMILE-4 (the Survival of Myocardial Infarction Long-term…

Ramiprilmedicine.medical_specialtyCost effectivenessEconomics Econometrics and Finance (miscellaneous)Populationacute myocardial infarctionramiprilchemistry.chemical_compoundInternal medicinePost-hoc analysismedicinezofenoprilMyocardial infarctioneducationcost-effectivenesshealth care economics and organizationsOriginal Researchleft ventricular dysfunctioneducation.field_of_studylcsh:R5-920business.industryHealth Policylcsh:RM1-950acetylsalicylic acidmedicine.diseaseSMILE studycost effectiveness analysis (CEA)Confidence intervalZofenoprilangiotensin-converting enzyme inhibitorsClinicoEconomics and Outcomes Researchlcsh:Therapeutics. PharmacologychemistryCardiologyNumber needed to treatMedical emergencybusinesslcsh:Medicine (General)medicine.drug
researchProduct

Visit-to-visit blood pressure variability and renal outcomes: results from ONTARGET and TRANSCEND trials.

2020

AIMS There is conflicting evidence on whether in treated hypertensive patients the risk of renal outcomes is associated with visit-to-visit SBP variability. Furthermore, limited evidence is available on how important is SBP variability for prediction of renal outcomes compared with on-treatment mean SBP. We addressed these issues in 28 790 participants of the Ongoing Treatment Alone and in combination with Ramipril Global End point Trial and Telmisartan Randomized Assessment Study in ace iNtolerant Subjects with Cardiovascular Disease trials. METHODS AND RESULTS SBP variability was expressed as the coefficient of variation of the mean with which it showed no relationship. SBP variability an…

Ramiprilmedicine.medical_specialtyPhysiologyBlood Pressure030204 cardiovascular system & hematologyurologic and male genital diseases03 medical and health scienceschemistry.chemical_compound0302 clinical medicineInternal medicineInternal MedicineMedicineHumanscardiovascular diseases030212 general & internal medicineAntihypertensive AgentsCreatininebusiness.industryIncidence (epidemiology)Confoundingmedicine.diseaseBlood pressureMean blood pressurechemistryCreatinineHypertensionCardiologyKidney Failure ChronicMicroalbuminuriaTelmisartanCardiology and Cardiovascular Medicinebusinesscirculatory and respiratory physiologymedicine.drugJournal of hypertension
researchProduct

Cardiovascular outcomes in patients at high cardiovascular risk with previous myocardial infarction or stroke.

2021

BACKGROUND Guidelines recommend to start blood pressure (BP)-lowering drugs also according to cardiovascular risk including history of cardiovascular events. We hypothesized that in patients with a history of myocardial infarction (MI), stroke, both or none of those, the index events predict the next event and have different SBP risk associations to different cardiovascular outcomes. DESIGN AND MEASUREMENTS In this pooled posthoc, nonprespecified analysis, we assessed outcome data from high-risk patients aged 55 years or older with a history of cardiovascular events or proven cardiovascular disease, randomized to the Ongoing Telmisartan Alone and in Combination with Ramipril Global Endpoint…

Ramiprilmedicine.medical_specialtyPhysiologyMyocardial InfarctionAngiotensin-Converting Enzyme InhibitorsRisk FactorsInternal medicineInternal MedicinemedicineHumansMyocardial infarctionStrokebusiness.industryProportional hazards modelHazard ratiomedicine.diseaseConfidence intervalClinical trialStrokeTreatment OutcomeCardiovascular DiseasesHeart Disease Risk FactorsCardiologyTelmisartanCardiology and Cardiovascular Medicinebusinessmedicine.drugJournal of hypertension
researchProduct

Renal outcomes and blood pressure patterns in diabetic and nondiabetic individuals at high cardiovascular risk

2021

Background Diabetes and hypertension are risk factors for renal and cardiovascular outcomes. Data on the association of achieved blood pressure (BP) with renal outcomes in patients with and without diabetes are sparse. We investigated the association of achieved SBP, DBP with renal outcomes and urinary albumin excretion (UAE) in people with vascular disease. Methods In this pooled analysis, we assessed renal outcome data from high-risk patients aged 55 years or older with a history of cardiovascular disease, 70% of whom had hypertension, randomized to The Ongoing Telmisartan Alone and in Combination with Ramipril Global Endpoint Trial and to Telmisartan Randomized Assessment Study in ACE In…

Ramiprilmedicine.medical_specialtyPhysiologyRenal functionAngiotensin-Converting Enzyme InhibitorsBlood Pressure030204 cardiovascular system & hematologyBenzoates03 medical and health scienceschemistry.chemical_compound0302 clinical medicineRisk FactorsInternal medicineDiabetes mellitusDiabetes MellitusInternal MedicinemedicineHumans030212 general & internal medicineCreatininebusiness.industryHazard ratioMiddle Agedmedicine.diseasechemistryCardiovascular DiseasesHeart Disease Risk FactorsHypertensionAlbuminuriaMicroalbuminuriamedicine.symptomTelmisartanCardiology and Cardiovascular Medicinebusinessmedicine.drugJournal of Hypertension
researchProduct

Statins and peripheral arterial disease: effects on claudication, disease progression, and prevention of cardiovascular events.

2006

Peripheral arterial disease (PAD) of the lower limbs is the third most important site of atherosclerotic disease alongside coronary heart disease (CHD) and cerebrovascular disease (CVD). Best medical treatment is beneficial even in patients who eventually need invasive treatment, as the safety, immediate success, and durability of intervention is greatly improved in patients who adhere to best medical treatment. In recent years, a number of studies have suggested that the ACE-inhibitor ramipril and different statins, together with antiplatelet drugs, reduce cardiovascular morbidity and mortality in PAD. Patients with PAD are really a category of patients with a very high cardiovascular risk…

Ramiprilmedicine.medical_specialtyRenal functionCoronary Diseasechemistry.chemical_compoundRisk FactorsInternal medicinemedicineHumanscardiovascular diseasesPeripheral Vascular DiseasesFramingham Risk ScoreCholesterolbusiness.industryAnticholesteremic AgentsGeneral MedicineArteriesCholesterol LDLIntermittent ClaudicationAtherosclerosisIntermittent claudicationPeripheralchemistryHemostasisCardiologyDisease Progressionmedicine.symptomHydroxymethylglutaryl-CoA Reductase InhibitorsClaudicationbusinessmedicine.drugArchives of medical research
researchProduct

Randomised comparison of zofenopril and ramipril plus acetylsalicylic acid in postmyocardial infarction patients with left ventricular systolic dysfu…

2015

Objective Conflicting evidence exists on the benefits of treating patients with coronary artery disease and preserved left ventricular ejection fraction (LVEF) with an ACE inhibitor. This retrospective analysis of the SMILE-4 Study sought to compare the efficacy of zofenopril 60 mg plus acetylsalicylic acid (ASA) versus ramipril 10 mg plus ASA 100 mg in patients with acute myocardial infarction (AMI) and heart failure, according to an impaired or preserved LVEF. Methods The primary study end point was 1-year combined occurrence of death or hospitalisation for cardiovascular causes. A preserved LVEF was defined by a baseline LVEF >40% and an impaired one by an LVEF ≤40%. Results 448 patients…

Ramiprilmedicine.medical_specialtyacute myocardial infarctionInfarctionramiprilCoronary Artery DiseaseCoronary artery diseasechemistry.chemical_compoundInternal medicinemedicinezofenopril1506cardiovascular diseasesMyocardial infarctionleft ventricular dysfunctionEjection fractionbusiness.industryleft ventricular ejection fractionmedicine.diseaseZofenoprilangiotensin-converting enzyme inhibitorsangiotensin-converting enzyme inhibitorchemistryacute myocardial infarction; angiotensin-converting enzyme inhibitors; left ventricular dysfunction; left ventricular ejection fractionHeart failureACE inhibitorcardiovascular systemCardiologyCardiology and Cardiovascular Medicinebusinesscirculatory and respiratory physiologyBiomedical engineeringmedicine.drugOpen Heart
researchProduct

Achieved blood pressure and cardiovascular outcomes in high-risk patients: results from ONTARGET and TRANSCEND trials

2017

Summary Background Studies have challenged the appropriateness of accepted blood pressure targets. We hypothesised that different levels of low blood pressure are associated with benefit for some, but harm for other outcomes. Methods In this analysis, we assessed the previously reported outcome data from high-risk patients aged 55 years or older with a history of cardiovascular disease, 70% of whom had hypertension, from the ONTARGET and TRANSCEND trials investigating ramipril, telmisartan, and their combination, with a median follow-up of 56 months. Detailed descriptions of randomisation and intervention have already been reported. We analysed the associations between mean blood pressure a…

Ramiprilmedicine.medical_specialtybusiness.industryMedicine (all)General Medicine030204 cardiovascular system & hematologymedicine.diseasePrehypertensionSurgery03 medical and health sciences0302 clinical medicineBlood pressureMean blood pressureHeart failureInternal medicinemedicineCardiology030212 general & internal medicineMyocardial infarctionTelmisartanbusinessStrokemedicine.drug
researchProduct

Cardiovascular outcomes and achieved blood pressure in patients with and without diabetes at high cardiovascular risk

2019

Abstract Aims Studies have shown a non-linear relationship between systolic blood pressure (SBP) and diastolic blood pressure (DBP) and outcomes, with increased risk observed at both low and high blood pressure (BP) levels. We hypothesized that the BP-risk association is different in individuals with and without diabetes at high cardiovascular risk. Methods and results We identified patients with (N = 11 487) or without diabetes (N = 19 450), from 30 937 patients, from 133 centres in 44 countries with a median follow-up of 56 months in the ONTARGET/TRANSCEND studies. Patients had a prior history of stroke, myocardial infarction (MI), peripheral artery disease, or were high-risk diabetics. P…

Ramiprilmedicine.medical_specialtyhypertensionSystoleAngiotensin-Converting Enzyme Inhibitors030204 cardiovascular system & hematologyPeripheral Arterial Disease03 medical and health sciences0302 clinical medicineRamiprilDiastoleRisk FactorsInternal medicineDiabetes mellitusDiabetes MellitusmedicineHumanshigh cardiovascular riskTelmisartan030212 general & internal medicineMyocardial infarctionStrokeRetrospective StudiesHeart Failurediabetesbusiness.industryHazard ratioblood pressureBlood Pressure Determinationmedicine.diseasestrokeHospitalizationmyocardial infarctionBlood pressureCardiovascular DiseasesCase-Control StudiesHeart failureCardiologyDrug Therapy CombinationTelmisartanCardiology and Cardiovascular MedicinebusinessAngiotensin II Type 1 Receptor Blockersmedicine.drugEuropean Heart Journal
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Angiotensin-Converting Enzyme Inhibitor Ramiprilat Interferes With the Sequestration of the B 2 Kinin Receptor Within the Plasma Membrane of Native E…

1999

Background —ACE (kininase II) inhibitors have been shown to exert their beneficial cardiovascular effects via the inhibition of both angiotensin II formation and bradykinin breakdown. Because recent evidence suggests that ACE inhibitors may also interfere with B 2 kinin receptor signaling and thus enhance the vascular response to bradykinin, we examined whether the distribution of B 2 kinin receptors within the plasma membrane of native endothelial cells is affected by an ACE inhibitor. Methods and Results —Localization of the B 2 kinin receptor in membranes prepared from native porcine aortic endothelial cells was evaluated by means of specific [ 3 H]bradykinin binding and immunoprecipita…

medicine.medical_specialtyReceptor Bradykinin B2SwineBradykininAngiotensin-Converting Enzyme InhibitorsPharmacologyBradykininchemistry.chemical_compoundRamiprilPhysiology (medical)Internal medicinemedicineAnimalsCalcium SignalingBradykinin receptorReceptorAortaMitogen-Activated Protein Kinase 1Mitogen-Activated Protein Kinase 3biologyReceptors BradykininMembrane ProteinsBiological TransportAngiotensin-converting enzymeKininAngiotensin IIEndothelial stem cellEndocrinologychemistryCalcium-Calmodulin-Dependent Protein Kinasesbiology.proteinEndothelium VascularMitogen-Activated Protein KinasesCardiology and Cardiovascular MedicineRamiprilatSignal TransductionCirculation
researchProduct