Search results for "Roca"

showing 10 items of 1893 documents

Selective Synthesis of Z -Silyl Enol Ethers via Ni-Catalyzed Remote Functionalization of Ketones

2021

Journal of the American Chemical Society : JACS 143(22), 8375-8380 (2021). doi:10.1021/jacs.1c01797

ketonesSilylationDimerketonit010402 general chemistry01 natural sciencesBiochemistrytransition metalsCatalysisCatalysischemistry.chemical_compoundkatalyytitColloid and Surface ChemistryPolymer chemistryhydrocarbonsoligomerseetteritkemiallinen synteesiOlefin fiberGeneral ChemistrySilyl enol ether540Enolhiilivedyt3. Good health0104 chemical sciencesoligomeerietherschemistryChain walkingddc:540nikkeliSelectivityJournal of the American Chemical Society
researchProduct

The Positive Spiral Between Problem-Solving Management and Trust: A Study in Organizations for Individuals With Intellectual Disability

2021

To achieve their goals, organizations for individuals with intellectual disability have to stimulate high-quality relationships between professionals and family members. Therefore, achieving professionals’ trust in family members has become a challenge. One relevant factor in explaining professional’s trust in families is the degree to which family members use the “problem-solving” conflict management strategy (high concern for oneself but also for the other party) in their disputes–disagreements with professionals. It is reasonable to argue that when family members use problem-solving conflict management, professionals’ trust increases. Professionals’ trust, in turn, stimulates the use of …

lcsh:BF1-990conflict management050109 social psychologyStructural equation modelingproblem-solving0502 economics and businessIntellectual disabilitymedicinePsychology0501 psychology and cognitive sciencesorganizations for individuals with intellectual disabilityCausationGeneral PsychologyOriginal Researchdynamic05 social sciencesreciprocalSurvey researchtrustprofessionalsfamiliesmedicine.diseaseCausalitylcsh:PsychologyConflict managementPsychologySocial psychology050203 business & managementReciprocalFrontiers in Psychology
researchProduct

Screening of halogenated aromatic compounds in some raw material lots for an aluminium recycling plant

2004

Four samples of scrap raw materials for an aluminium recycling plant were screened for the occurrence of persistent halogenated aromatic compounds. The samples contained waste from handling of electric and electronic plastics, filter dust from electronic crusher, cyclone dust from electronic crusher and light fluff from car shredder. In our screening analyses, brominated flame retardants were observed in all samples. Polybrominated diphenyl ethers (PBDE) were identified in all samples in amounts of 245–67450 ng/g. The major PBDE congeners found were decabromo- and pentabromodiphenyl ethers. 1,1-bis(2,4,6-tribromophenoxy)ethane, hexabromobenzene, ethyl-pentabromobenzene, tetrabromobisphenol-…

lcsh:GE1-350Conservation of Natural ResourcesWaste managementPhenyl EthersPolybrominated BiphenylsIndustrial WasteAluminium recyclingScrapRaw materialHydrocarbons AromaticHydrocarbons Brominatedchemistry.chemical_compoundPolybrominated diphenyl etherschemistryEnvironmental chemistryHexabromobenzeneHalogenated Diphenyl EthersSoil PollutantsPentabromotolueneWater Pollutants Chemicallcsh:Environmental sciencesAluminumEnvironmental MonitoringFlame RetardantsGeneral Environmental ScienceEnvironment International
researchProduct

Hazardous air pollutants and primary liver cancer in Texas.

2016

The incidence of hepatocellular carcinoma (HCC), the most common primary liver cancer, is increasing in the US and tripled during the past two decades. The reasons for such phenomenon remain poorly understood. Texas is among continental states with the highest incidence of liver cancer with an annual increment of 5.7%. Established risk factors for HCC include Hepatitis B and C (HBV, HCV) viral infection, alcohol, tobacco and suspected risk factors include obesity and diabetes. While distribution of these risk factors in the state of Texas is similar to the national data and homogeneous, the incidence of HCC in this state is exceptionally higher than the national average and appears to be di…

lcsh:Medicine010501 environmental sciences01 natural sciencesGeographical locations0302 clinical medicineRisk FactorsEpidemiology of cancerMedicine and Health SciencesMedicineOrganic Chemicalslcsh:Scienceeducation.field_of_studyAir PollutantsPrincipal Component AnalysisMultidisciplinaryOrganic CompoundsIncidence (epidemiology)IncidenceLiver DiseasesLiver NeoplasmsHepatitis BTexasPollutionChemistryOncology030220 oncology & carcinogenesisPhysical SciencesEngineering and TechnologyLiver cancerEnvironmental MonitoringResearch ArticlePollutantsCarcinoma HepatocellularEnvironmental EngineeringPopulationGastroenterology and HepatologyXylenesCarcinomas03 medical and health sciencesEnvironmental healthAir PollutionAromatic HydrocarbonsGastrointestinal TumorsHumansEnvironmental ChemistryRisk factoreducation0105 earth and related environmental sciencesbusiness.industrylcsh:REcology and Environmental SciencesOrganic ChemistryChemical CompoundsCancerCancers and NeoplasmsBenzeneEnvironmental ExposureHepatocellular Carcinomamedicine.diseaseUnited StatesHydrocarbonsCancer registryNorth Americalcsh:QHydrochloric AcidPeople and placesbusinessAcidsToluenePloS one
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Interactive effects of past and present environments on overwintering success - A reciprocal transplant experiment

2012

Life-history traits are influenced by environmental factors throughout the lifespan of an individual. The relative importance of past versus present environment on individual fitness, therefore, is a relevant question in populations that face the challenge of temporally varying environment. We studied the interacting effects of past and present density on body mass, condition, and survival in enclosure populations of the bank vole (Myodes glareolus) using a reciprocal transplant design. In connection with the cyclic dynamics of natural vole populations, our hypothesis was that individuals born in low-density enclosures would do better overwintering in low-density enclosures than in high-den…

life historyelinkiertoreciprocal transplant experimentvastavuoroinen siirtokoeviivästynyt tiheydestä riippuvuusMyodes glareoluspopulation dynamicsdelayed density dependencepopulaatiodynamiikka
researchProduct

Interactive effects of past and present environments on overwintering success-a reciprocal transplant experiment.

2011

Life-history traits are influenced by environmental factors throughout the lifespan of an individual. The relative importance of past versus present environment on individual fitness, therefore, is a relevant question in populations that face the challenge of temporally varying environment. We studied the interacting effects of past and present density on body mass, condition, and survival in enclosure populations of the bank vole (Myodes glareolus) using a reciprocal transplant design. In connection with the cyclic dynamics of natural vole populations, our hypothesis was that individuals born in low-density enclosures would do better overwintering in low-density enclosures than in high-den…

life historyreciprocal transplant experimentDelayed density dependenceMyodes glareoluspopulation dynamicsOriginal ResearchEcology and evolution
researchProduct

Computational Criteria for Hydrogen Evolution Activity on Ligand-Protected Au25-Based Nanoclusters

2023

The hydrogen evolution reaction (HER) is a critical reaction in addressing climate change; however, it requires catalysts to be generated on an industrial scale. Nanomaterials offer several advantages over conventional HER catalysts, including the possibility of atomic precision in tailoring the intrinsic activity. Ligand-protected metal clusters, such as the thiolate-protected MAu24(SR)18 (where M is Au, Cu, Pd), are of particular interest as not only are they electrocatalytically active toward HER, but the charge state and composition can be precisely tuned. Here, we present a comprehensive computational study examining how the charge state and dopants affect the catalytic activity of [MA…

ligand protected clusterelektrokatalyysinanorakenteetgold nanoclustertiheysfunktionaaliteoriaelectrocatalysisHERdopingdensity functional theoryredox potential
researchProduct

Note sous Civ. 1ère, 28 novembre 2006

2007

International audience

loi marocaine[SHS.DROIT] Humanities and Social Sciences/Lawconvention franco-marocaine du 10 août 1981divorce[ SHS.DROIT ] Humanities and Social Sciences/Lawallocation pécuniaire après divorce insuffisanteDroit international privécontrariété à l'ordre public international françaisordre public internationaleffets entre époux[SHS.DROIT]Humanities and Social Sciences/Lawapplication du droit françaisconvention de La Haye du 2 octobre 1973ComputingMilieux_MISCELLANEOUSloi applicableprestation compensatoire
researchProduct

Dicyclopentaannelated Hexa-peri-hexabenzocoronenes with a Singlet Biradical Ground State

2021

Abstract Synthesis of two dicyclopentaannelated hexa‐peri‐hexabenzocoronene (PHBC) regioisomers was carried out, using nonplanar oligoaryl precursors with fluorenyl groups: mPHBC 8 with two pentagons in the “meta”‐configuration was obtained as a stable molecule, while its structural isomer with the “para”‐configuration, pPHBC 16, could be generated and characterized only in situ due to its high chemical reactivity. Both PHBCs exhibit low energy gaps, as reflected by UV‐vis‐NIR absorption and electrochemical measurements. They also show open‐shell singlet ground states according to electron paramagnetic resonance (EPR) measurements and density functional theory (DFT) calculations. The use of…

low energy gapnot-fully benzenoid PAH010402 general chemistryPhotochemistry01 natural sciencesCatalysislaw.inventiondicyclopentaannelationopen-shell biradicallawStructural isomerMoleculeSinglet stateElectron paramagnetic resonance010405 organic chemistryChemistryCommunicationAromaticityGeneral ChemistryCommunications0104 chemical sciencesDensity functional theoryPolycyclic Aromatic Hydrocarbons | Hot Paperhexa-peri-hexabenzocoroneneGround stateAntiaromaticityAngewandte Chemie International Edition
researchProduct