Search results for "Rocard"

showing 10 items of 442 documents

Genetic and environmental effects on resting electrocardiography and the association between electrocardiography and physical activity, walking endur…

2010

endurancekuolleisuusympäristötekijätelectrocardiographyenvironmental effectslepophysical activityKaksostutkimustwinsmortalitykävelykaksosetwalkingagedleisureperimärestkestävyysEKGliikuntaharrastusgenomeikääntyneet
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Bioelectric model of atrial fibrillation: Applicability of blind source separation techniques for atrial activity estimation in atrial fibrillation e…

2003

In this contribution, we present the theoretical justification that give support to the suitability of blind signal separation (BSS) techniques for the estimation of the atrial activity (AA) present in ECGs of persistent atrial fibrillation (AF). The application of BSS methods to this problem needs the fulfillment of several conditions regarding AA, ventricular activity (VA) and the fashion in which both activities arise on the body surface, that will be justified along the paper. To empirically validate the model, an ICA method is applied to 10 real 12-lead recordings of AF. The identification of AA is put forward based on kurtosis and spectral analysis. The kurtosis value of the estimated…

medicine.diagnostic_testComputer scienceSpeech recognitionPersistent atrial fibrillationKurtosismedicineSpectral analysisAtrial fibrillationmedicine.diseaseElectrocardiographyBlind signal separationAlgorithm
researchProduct

Recognition of Cardiac Arrhythmia by Means of Beat Clustering on ECG-Holter Recordings

2012

The follow-up of some cardiac diseases may be achieved by ECG-holter record analysis. A heartbeat clustering method can be used to reduce the usually high computational cost of such Holter analysis. This study describes a method aimed at cardiac arrhythmia recognition based on this approach, by means of unsupervised inspection of morphologically similar heartbeat groups. Singular Value Decomposition (SVD) is used as the feature selection method since the complexity increases exponentially with the number of features. A modification of the k-means algorithm was developed for centroid computation, taking into account heartbeat length changes. Experimental set consisted of ECG records from the…

medicine.diagnostic_testHeartbeatComputer sciencebusiness.industryFeature extractionCentroidCardiac arrhythmiaFeature selectionPattern recognitionSingular value decompositioncardiovascular systemmedicineArtificial intelligenceCluster analysisbusinessElectrocardiographycirculatory and respiratory physiology
researchProduct

Miniature wireless photoplethysmography devices: integration in garments and test measurements

2012

Wireless PPG devices were developed and embedded in everyday clothes (bandage, scarf, cycling glove and wrist strap) to monitor cardiovascular state of free-moving persons. The corresponding software for measurements also has been developed and tested in laboratory. Real-time measurements of PPG signals were taken in parallel with a professional ECG reference device, and high correlation was demonstrated.

medicine.diagnostic_testbusiness.industryComputer sciencePhotoplethysmogramEmbedded systemmedicineWirelessbusinessElectrocardiographyComputer hardwareWearable technologySPIE Proceedings
researchProduct

A second-degree atrioventricular block with double escape rhythm secondary to paroxysmal vagal hypertonia.

2017

medicine.diagnostic_testbusiness.industryVagus NerveGeneral Medicine030204 cardiovascular system & hematologyMiddle Agedmedicine.diseaseVagus nerve03 medical and health sciencesElectrocardiography0302 clinical medicineRhythmAnesthesiaMedicineHypertoniaHumans030212 general & internal medicinemedicine.symptomCardiology and Cardiovascular MedicinebusinessAtrioventricular BlockAtrioventricular blockElectrocardiographySecond-degree atrioventricular blockJournal of cardiovascular medicine (Hagerstown, Md.)
researchProduct

Electrocardiographic Indices of Left Ventricular Hypertrophy and Repolarization Phase Share the Same Genetic Influences: A Twin Study

2009

Background: Both left ventricular hypertrophy (LVH) and repolarization phase (RP) are known to be attributable to genetic influences, but less is known whether they share same genetic influences. The aim of this study was to investigate to what extent individual differences in electrocardiographic (ECG) LVH and RP are explained by genetic and environmental influences and whether these influences are shared between these two traits. Methods: Resting ECG recordings were obtained from 186 monozygotic and 203 dizygotic female twin individuals, aged 63 to 76 years. Latent factors, called LVH and RP, were formed to condense the information obtained from LVH indices (Cornell voltage and Cornell pr…

medicine.medical_specialty030204 cardiovascular system & hematologyLeft ventricular hypertrophyGenetic correlationCorrelationElectrocardiography03 medical and health sciences0302 clinical medicinePhysiology (medical)Internal medicineGenetic modelingHumansRepolarizationMedicineGenetic Predisposition to Diseasecardiovascular diseases030212 general & internal medicineAgedbusiness.industryOriginal ArticlesGeneral MedicineMiddle AgedHeritabilitymedicine.diseaseTwin studyEndocrinologyCardiologyFemaleHypertrophy Left VentricularCardiology and Cardiovascular MedicinebusinessAnnals of Noninvasive Electrocardiology
researchProduct

Why does C-reactive protein increase in non-ST elevation acute coronary syndromes?

2003

Abstract Introduction: C-reactive protein is an important prognostic indicator for early risk stratification in patients with an acute coronary syndrome. The mechanisms underlying the elevation of C-reactive protein in these patients have not been fully understood. We studied the factors related to the increase of this acute-phase reactant. Methods and Results: Within a single-centre registry, 419 consecutive patients admitted for a non-ST elevation acute coronary syndrome were studied. Serum high sensitivity C-reactive protein was measured late (median 3 days) after admission. Clinical, electrocardiographic, biochemical and angiographic variables were recorded. In the multivariate analysis…

medicine.medical_specialtyAcute coronary syndromebiologymedicine.diagnostic_testbusiness.industryUnstable anginaST elevationC-reactive proteinmedicine.diseaseTroponinInternal medicineTroponin Ibiology.proteinCardiologyMedicineMyocardial infarctionCardiology and Cardiovascular MedicinebusinessElectrocardiographyInternational Journal of Cardiology
researchProduct

Genetic influences on resting electrocardiographic variables in older women: a twin study.

2009

Background: Previous studies in young and middle-aged men and women have shown that resting electrocardiographic (ECG) variables are influenced by genetic factors. However, the extent to which resting ECG variables are influenced by genetic factors in older women is unknown. Thus, the aim of this study was to estimate the relative contribution of genetic and environmental influences to individual differences in resting ECG variables among older female twins without overt cardiac diseases. Methods: Resting ECG recordings were obtained from 186 monozygotic and 203 dizygotic twin individuals, aged 63–76 years. Quantitative genetic modeling was used to decompose the phenotypic variance in each …

medicine.medical_specialtyAgingDizygotic twinRestTwins030204 cardiovascular system & hematologyQT intervalCohort Studies03 medical and health sciencesQRS complexElectrocardiography0302 clinical medicineHeart RateReference ValuesPhysiology (medical)Internal medicineHeart ratemedicineConfidence IntervalsTwins DizygoticHumansGenetic Predisposition to Diseasecardiovascular diseasesFinland030304 developmental biologyAged0303 health sciencesmedicine.diagnostic_testbusiness.industryGeneral MedicineTwins MonozygoticOriginal ArticlesHeritabilityMiddle AgedTwin studyConfidence intervalEndocrinologyCardiologyFemaleCardiology and Cardiovascular MedicinebusinessElectrocardiographyAnnals of noninvasive electrocardiology : the official journal of the International Society for Holter and Noninvasive Electrocardiology, Inc
researchProduct

Autonomic dysfunction in a group of lower extremities arterial disease outpatients.

2021

Background: The understanding of the specific role of sympathetic neural control and dysregulation in lower extremities arterial disease (LEAD) is still very limited. Aim of our study was to investigate the autonomic profile in LEAD patients and to evaluate if the eventual autonomic alterations were more severe in patients with advanced disease. Methods: We enrolled all consecutive outpatients with LEAD referred to our Departments between July 2012 and September 2014. They were compared to a group of matched outpatients without LEAD. All patients underwent Holter ECG monitoring. Time-domain analysis of heart rate variability (HRV) was evaluated. Results: Compared to controls, patients with …

medicine.medical_specialtyArterial diseasebusiness.industrySevere diseaseDiseaseAutonomic Nervous SystemLower ExtremityHeart RateInternal medicineOutpatientsAdvanced diseaseCardiologyElectrocardiography AmbulatoryMedicineHeart rate variabilityHumansStage (cooking)Cardiology and Cardiovascular MedicineLead (electronics)businessHumanHolter ecgMinerva cardiology and angiology
researchProduct