Search results for "SMAP"

showing 7 items of 37 documents

Assessment and inter-comparison of recently developed/reprocessed microwave satellite soil moisture products using ISMN ground-based measurements

2019

Soil moisture (SM) is a key state variable in understanding the climate system through its control on the land surface energy, water budget partitioning, and the carbon cycle. Monitoring SM at regional scale has become possible thanks to microwave remote sensing. In the past two decades, several satellites were launched carrying on board either radiometer (passive) or radar (active) or both sensors in different frequency bands with various spatial and temporal resolutions. Soil moisture algorithms are in rapid development and their improvements/revisions are ongoing. The latest SM retrieval products and versions of products that have been recently released are not yet, to our knowledge, com…

TechnologyPassive microwave remote sensing010504 meteorology & atmospheric sciences0208 environmental biotechnologyActive microwave remote sensingReview02 engineering and technology01 natural sciences7. Clean energylaw.inventionRemote SensinglawRadarEvaluationComputingMilieux_MISCELLANEOUSevaluationGeologypassive microwave remote sensingDATA SETSLife Sciences & Biomedicineactive microwave remote sensingSMOSLAND SURFACESreviewSoil ScienceClimate changeEnvironmental Sciences & EcologyLand coverVALIDATIONRETRIEVALSInternational soil moisture networkComputers in Earth SciencesImaging Science & Photographic Technology[SDU.ENVI]Sciences of the Universe [physics]/Continental interfaces environment0105 earth and related environmental sciencesRemote sensingScience & TechnologyRadiometerAMSR-ESMAPScatterometerinternational soil moisture network020801 environmental engineeringCLIMATEASCAT13. Climate actionSoil waterEnvironmental scienceSpatial variabilitySatelliteSoil moisturesoil moistureEnvironmental SciencesL-BANDRemote Sensing of Environment
researchProduct

SMAP Multi-Temporal vegetation optical depth retrieval as an indicator of crop yield trends and crop composition

2017

Vegetation Optical Depth (VOD) is related to Vegetation Water Content (VWC). This provides new and highly valuable information for ecological and agricultural studies. In this work, VOD from the Soil Moisture Active-Passive (SMAP) satellite has been retrieved with the new Multi-Temporal Dual-Channel Algorithm (MT-DCA). Then, it has been applied to the study of crop yield trends and crop composition. The increase on VOD (¿VOD) during crop development has been compared to yield data in two selected regions located in the United States. The first region presents a heterogeneous crop composition and weak ¿VOD-yield relationship (r2=0.21). The second region presents a highly homogenous cover and…

YieldTeledetecció010504 meteorology & atmospheric sciencesAgricultural engineering0211 other engineering and technologiesCropsSoil science:Enginyeria agroalimentària [Àrees temàtiques de la UPC]02 engineering and technology01 natural sciencesCropYield (wine)Enginyeria agronòmicaVegetation optical depthWater content021101 geological & geomatics engineering0105 earth and related environmental sciences2. Zero hungerbusiness.industrySaturation (genetic)Crop yieldPlant densitySMAPRemote sensing15. Life on land:Enginyeria de la telecomunicació::Radiocomunicació i exploració electromagnètica::Teledetecció [Àrees temàtiques de la UPC]AgricultureEnvironmental scienceSatelliteComposition (visual arts)business2017 IEEE International Geoscience and Remote Sensing Symposium (IGARSS)
researchProduct

ECR-ionilähteiden plasmapotentiaali ja ambipolaarinen diffuusio

2005

ionitECR-ionilähteetplasmapotentiaaliplasmatekniikkafysiikkaambipolaarinen diffuusio
researchProduct

Therapeutic plasma exchange: Review of current indications

2019

Therapeutic plasma exchange (TPE) is the extracorporeal technique performed in an apheresis device were patient's plasma is separated from whole blood and removed, while the cellular blood components are returned to the patient together with a replacement fluid. By the extracorporeal removal of pathological substances and the replacement of deficient plasma components, it constitutes an important tool for the management of several disorders and it is a well-known and established treatment for numerous diseases. Additionally, overall available data confirm the safety and efficacy of TPE. Nevertheless, the quality of the evidence supporting the utility and efficacy of the procedure is diverse…

medicine.medical_specialtyPlasma Exchangebusiness.industryPlasmapheresisHematology030204 cardiovascular system & hematologyExtracorporeal03 medical and health sciences0302 clinical medicineApheresismedicineHumansExtracorporeal techniqueTherapeutic plasma exchangeIntensive care medicinebusiness030215 immunologyWhole bloodTransfusion and Apheresis Science
researchProduct

Thrombotic thrombocytopenic purpura (TTP) leading to pseudotumour's autoimmune pancreatitis (AIP): A case report

2012

International audience; Introduction: Autoimmune pancreatitis is an idiopathic inflammatory disease that produces pancreatic masses and ductal strictures. This benign disease can be associated with extrapancreatic manifestations including cholangitis, sialadenitis, inflammatory bowel disease or retroperitoneal fibrosis, mediastinal adenopathy, interstitial nephritis mainly due to immunoglobulin G4 (Ig G4), and occasional association with other auto-immune diseases. Observation: We report a 57-year-old woman who developed thrombotic thrombocytopenic purpura (UP) and pseudo-tumour's seronegative autoimmune pancreatitis (ATP) type 1. The patient was initially treated with pulse corticosteroids…

medicine.medical_specialtyVON-WILLEBRAND-FACTOREndocrinology Diabetes and Metabolismmedicine.medical_treatmentInterstitial nephritisAnti-Inflammatory AgentsThrombotic thrombocytopenic purpuraRetroperitoneal fibrosisGastroenterologyInflammatory bowel diseaseDISEASEAutoimmune DiseasesAntibodies Monoclonal Murine-Derived03 medical and health sciences0302 clinical medicineThrombotic thrombocytopenic purpuraInternal medicine[SDV.IDA]Life Sciences [q-bio]/Food engineeringmedicineHumans[SPI.GPROC]Engineering Sciences [physics]/Chemical and Process EngineeringSYSTEMIC-LUPUS-ERYTHEMATOSUSAutoimmune pancreatitisAutoimmune pancreatitisPurpura Thrombotic ThrombocytopenicHepatologybusiness.industryENTITYGastroenterologyMiddle Agedmedicine.diseaseSialadenitis3. Good healthPancreatitis030220 oncology & carcinogenesisImmunologyFemale030211 gastroenterology & hepatologyRituximabPlasmapheresismedicine.symptombusinessRituximabmedicine.drug
researchProduct

Albumin versus solvent/detergent-treated pooled plasma as replacement fluid for long-term plasma exchange therapy in a patient with primary hypertrig…

2015

BACKGROUND Chylomicronemia syndrome is a metabolic condition characterized by severe fasting hypertrigliceridemia (≥1000 mg/dL) and other clinical features including chronic abdominal pain and recurrent acute pancreatitis. In patients with acute or recurrent pancreatitis, plasma exchange (PEx) is indicated for the treatment of acute disease and prevention of recurrence. The use of plasma instead of albumin as replacement fluid has been suggested for its putative ability to replace the deficient enzyme possibly leading to better clinical improvement. CASE REPORT A 40-year-old man with chylomicronemia syndrome due to a newly identified loss-of-function mutation in the lipoprotein lipase (LPL)…

medicine.medical_specialtymedicine.medical_treatmentImmunologySerum albumin030204 cardiovascular system & hematologyGastroenterology03 medical and health scienceschemistry.chemical_compound0302 clinical medicineRecurrent pancreatitisInternal medicinemedicineImmunology and AllergyLipoprotein lipaseTriglyceridebiologybusiness.industryAlbuminHematologymedicine.diseaseEndocrinologychemistry030220 oncology & carcinogenesisbiology.proteinPancreatitisAcute pancreatitisPlasmapheresisbusinessTransfusion
researchProduct

Immune-mediated rippling muscle disease with myasthenia gravis: a report of seven patients with long-term follow-up in two.

2009

We report seven patients with immune-mediated rippling muscle disease (iRMD) and AChR-antibody positive myasthenia gravis (MG) without germline caveolin-3 gene mutations. We describe the follow-up of two patients and the clinical features of five new patients (1 female, 4 male, aged 32 to 69 years). These presented with significant generalized, exercise-induced and electrically-silent muscle rippling with myalgia, combined with generalized MG. In two of the seven patients, MG appeared before iRMD. Mediastinal imaging excluded thymic alterations in all, although two had other coincident tumours. Myalgia and rippling were aggravated by acetylcholinesterase-inhibitor treatment. Generalized MG …

myalgiaAdultMalePathologymedicine.medical_specialtyCaveolin 3Immunogenicmedicine.medical_treatmentMuscle Fibers SkeletalMuscle ProteinsCaveolin-3; Immunogenic; Myasthenia gravis; Rippling muscle disease; TherapyAzathioprineThymus GlandGene mutationBiologyCaveolaeDysferlinCaveolin-3Muscular DiseasesAzathioprineMyasthenia GravismedicineHumansMuscle SkeletalGenetics (clinical)AgedAutoantibodiesSarcolemmaElectromyographyAutoantibodyRippling muscle diseasePlasmapheresisMiddle Agedmedicine.diseaseMyasthenia gravisNeurologyPediatrics Perinatology and Child Healthbiology.proteinPlasmapheresisFemaleSteroidsTherapyNeurology (clinical)Cholinesterase Inhibitorsmedicine.symptommedicine.drugFollow-Up StudiesMuscle ContractionNeuromuscular disorders : NMD
researchProduct