Search results for "STATISTICS"

showing 10 items of 7671 documents

Generic Data Models for Semantic e-Government Interoperability : Literature Review

2014

Interoperability of e-government systems is suggested to increase transparency, efficiency, effectiveness, and customer service in the public sector. Generic data models are often seen as a way for achieving especially semantic interoperability. To assess how the contemporary data models support semantic egovernment interoperability, we reviewed literature on data models suggested for the public sector in light of four features: standard modelling language, entityrelationship modelling, vocabulary for data exchange and methodology. The review contributes previous research by introducing a four-feature framework for assessing capability of e-government data models to enhance interoperability…

data- och systemvetenskapSystemvetenskap informationssystem och informatik med samhällsvetenskaplig inriktningStatisticsInformation Systems Social aspectscomputer and systems sciencepublic administrationInteroperabilitydata modelcomputer and systems science - Informaticsdata- och systemvetenskap - InformatikStatistikinformation modelyhteentoimivuusjulkinen hallinto
researchProduct

The reliability of spanish and german electricity forward prices. Databases and price discovery process

2021

Given the existence of different databases from different sources that offer information on forward electricity prices, the need to compare them arises to guarantee that research results and trading decisions based on them are not sensitive to the database used. We worked with forward electricity prices traded over the counter, closest month to maturity, covering the period from 2010 to 2016 for the Spanish over the counter (OTC) market, and from 2008 to 2016 for the German OTC market. The goal of this paper was to test whether there were significant discrepancies between the price series provided by two of the main agencies of financial information (Thomson Reuters and Bloomberg), as well …

databasesGeneral Mathematicscomputer.software_genre:CIENCIAS ECONÓMICAS [UNESCO]Price discoveryGerman0502 economics and businessComputer Science (miscellaneous)electricity050207 economicsEngineering (miscellaneous)Reliability (statistics)050208 financeprice discoveryDatabasebusiness.industrylcsh:Mathematics05 social sciencesUNESCO::CIENCIAS ECONÓMICASlcsh:QA1-939CausalityMaturity (finance)Data availabilitylanguage.human_languagelanguageOver-the-counterElectricitybusinesscomputer
researchProduct

Villes, densité et fractalité

1995

International audience; Ce bref article résumé les résultats d'analyses fractales effectuées sur les villes françaises à plusieurs dates pour deux niveaux d'observation: les tissus urbains caractérisés par la distribution spatiale des surfaces bâties d'une part, et le semis des villes de différentes tailles dans l'ensemble du territoire français d'autre part. Les méthodes de mesure sont rapidement expliquées, l'accent est mis sur la signification des nombres obtenus, leur comparaison d'une ville à l'autre et leur évolution au cours du temps.

densité[SHS.STAT]Humanities and Social Sciences/Methods and statistics[SHS.GEO] Humanities and Social Sciences/Geography[SHS.STAT] Humanities and Social Sciences/Methods and statisticsvillefractalité[SHS.GEO]Humanities and Social Sciences/Geographyréseau urbain[ SHS.STAT ] Humanities and Social Sciences/Methods and statistics[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

La autoevaluación. Una propuesta formativa e innovadora

2018

Título, resumen y palabras clave en español e inglés Número especial que acompaña al monográfico "Pedagogía escolar y social (2)" Resumen basado en el de la publicación Se propone la necesidad de potenciar la autoevaluación entre el profesorado iberoamericano como estrategia de mejora de las prácticas docentes y como recurso de formación. Es necesaria la formación en autoevaluación puesto que ésta facilita y beneficia el desarrollo y el crecimiento tanto personal como profesional. Se presentan tanto los supuestos teóricos y las implicaciones metodológicas que alimentan la implementación de prácticas autoevaluativas, como también, los resultados cualitativos obtenidos con una muestra de 150 …

desarrollo profesionalPoint (typography)Professional developmentSample (statistics)General Medicineautoevaluaciónpráctica pedagógicamejoralcsh:Education (General)formación de profesoresescuela públicaformaciónOrder (business)Pedagogydesarrollo de la personalidadSociologylcsh:L7-991Revista Iberoamericana de Educación
researchProduct

Somatosensory Deviance Detection ERPs and Their Relationship to Analogous Auditory ERPs and Interoceptive Accuracy

2022

Abstract. Automatic deviance detection has been widely explored in terms of mismatch responses (mismatch negativity or mismatch response) and P3a components of event-related potentials (ERPs) under a predictive coding framework; however, the somatosensory mismatch response has been investigated less often regarding the different types of changes than its auditory counterpart. It is not known whether the deviance detection responses from different modalities correlate, reflecting a general prediction error mechanism of the central nervous system. Furthermore, interoceptive functions have been associated with predictive coding theory, but whether interoceptive accuracy correlates with devian…

deviance detectionmedicine.medical_specialtyPhysiologyGeneral NeuroscienceaistitMismatch negativityhavaitseminenDeviance (statistics)Audiologyevent-related potentialsSomatosensory systemkuulokuulohavainnotsomatosensoryP3aNeuropsychology and Physiological PsychologyEvent-related potentialinteroceptive accuracymedicineauditorykognitiivinen neurotiedeaivotPsychologyJournal of Psychophysiology
researchProduct

Centile estimation for a proportion response variable.

2015

This paper introduces two general models for computing centiles when the response variable Y can take values between 0 and 1, inclusive of 0 or 1. The models developed are more flexible alternatives to the beta inflated distribution. The first proposed model employs a flexible four parameter logit skew Student t (logitSST) distribution to model the response variable Y on the unit interval (0, 1), excluding 0 and 1. This model is then extended to the inflated logitSST distribution for Y on the unit interval, including 1. The second model developed in this paper is a generalised Tobit model for Y on the unit interval, including 1. Applying these two models to (1-Y) rather than Y enables model…

dewey510Least-Squares AnalysiStatistics and ProbabilityMaleModels StatisticalLogistic ModelGeneralised Tobit modelEpidemiologyFractional dataLogit skew Student t distributionStatistical DistributionLogistic ModelsGAMLSSBeta inflated distributionHumansComputer SimulationSettore SECS-S/05 - Statistica SocialeLeast-Squares AnalysisSettore SECS-S/01 - StatisticaLungHumanStatistical DistributionsStatistics in medicine
researchProduct

Information and communication technologies and teacher education in the new paradigms of higher education

2018

Abstract Media use in the teaching process occurs in several forms. Information and communication technologies can be used as work equipment and teaching aids, as well as tools or curriculum units, particularly in higher education. Technological changes and new information technologies, in addition to substantive knowledge of the material, require from teachers creativity, knowledge, and the skills of the didactic design of teaching using modern multimedia tools. In Croatia, there is a lack of research aimed at assessing the initial state of computer literacy within the higher education institutions. The aim of this study was to determine the level of knowledge and digital competence of (no…

didactic challenges; digital competences; representative sample; survey sampling research; the purpose of the application of new technologiesComplementary and alternative medicineHigher educationInformation and Communications Technologybusiness.industrydidactic challenges ; digital competences ; representative sample ; survey sampling research ; the purpose of the application of new technologiesMathematics educationComputingMilieux_COMPUTERSANDEDUCATIONPharmaceutical SciencePharmacology (medical)Probability and statisticsbusinessTeacher education
researchProduct

Beyond Tandem Analysis: Joint Dimension Reduction and Clustering in R

2019

We present the R package clustrd which implements a class of methods that combine dimension reduction and clustering of continuous or categorical data. In particular, for continuous data, the package contains implementations of factorial K-means and reduced K-means; both methods combine principal component analysis with K-means clustering. For categorical data, the package provides MCA K-means, i-FCB and cluster correspondence analysis, which combine multiple correspondence analysis with K-means. Two examples on real data sets are provided to illustrate the usage of the main functions.

dimension reduction; clustering; principal component analysis; multiple correspondence analysis; K-meansStatistics and Probabilitydimension reduction clustering principal component analysis multiple correspon-dence analysis K-meansFactorialmultiple correspon-dence analysisMultiple correspondence analysiComputer sciencedimension reductionprincipal component analysisk-meansmultiple correspondence analysisPrincipal component analysicomputer.software_genre01 natural sciencesCorrespondence analysis010104 statistics & probabilityMultiple correspondence analysis0101 mathematicsCluster analysisCategorical variablelcsh:Statisticslcsh:HA1-4737Dimensionality reductionk-means clusteringK-meanPrincipal component analysisData miningHA29-32Statistics Probability and UncertaintycomputerSoftwareclusteringJournal of Statistical Software
researchProduct

Nonlinear Time-Series Adaptation for Land Cover Classification

2017

Automatic land cover classification from satellite image time series is of paramount relevance to assess vegetation and crop status, with important implications in agriculture, biofuels, and food. However, due to the high cost and human resources needed to characterize and classify land cover through field campaigns, a recurrent limiting factor is the lack of available labeled data. On top of this, the biophysical–geophysical variables exhibit particular temporal structures that need to be exploited. Land cover classification based on image time series is very complex because of the data manifold distortions through time. We propose the use of the kernel manifold alignment (KEMA) method for…

domain adaptationComputer science0211 other engineering and technologies02 engineering and technologyLand coverNormalized Difference Vegetation IndexVegetation coverkernel methods0202 electrical engineering electronic engineering information engineeringElectrical and Electronic EngineeringTime series021101 geological & geomatics engineeringRemote sensingManifold alignment[SHS.STAT]Humanities and Social Sciences/Methods and statisticsbusiness.industryVegetation15. Life on landGeotechnical Engineering and Engineering GeologyKernel methodKernel (image processing)Agriculturemanifold alignment020201 artificial intelligence & image processingSatellite Image Time SeriesLand cover classificationtime seriesScale (map)businessIEEE Geoscience and Remote Sensing Letters
researchProduct

Studying the double-frequency heating mode in ECRIS plasma using Kα diagnostics

2018

Despite the success of double-heating frequency in enhancing high charge state production, the underlying physics remains poorly understood. By combining three different diagnostic techniques i.e. Kα emission, optical emission and the extracted charge state distribution, it is now possible to assess the proposed explanations for the effectiveness of double-frequency heating against the experimental results. These results seem to indicate that the increase of plasma density accounts largely for the favorable behavior of this operation mode compared to single-frequency mode. peerReviewed

double-heating frequencyMaterials scienceta114syklotronitemissionMode (statistics)PlasmaAtomic physicsDouble frequencyplasmafysiikkaplasmaplasma (kaasut)emissio (fysiikka)
researchProduct