Search results for "Seizure."

showing 10 items of 203 documents

Acute symptomatic seizures in cerebral venous thrombosis

2020

© 2020 American Academy of Neurology

AdultMalemedicine.medical_specialtySubarachnoid hemorrhageInfarction030204 cardiovascular system & hematology03 medical and health sciences0302 clinical medicineModified Rankin ScaleRisk FactorsSeizuresInternal medicinemedicineHumans030212 general & internal medicineStrokeIntracerebral hemorrhageVenous Thrombosisbusiness.industrycerebral venous thrombosisSymptomatic seizuresOdds ratioMiddle Agedmedicine.diseaseThrombosisCerebral Veins3. Good healthVenous thrombosisAnesthesiaSettore MED/26 - NeurologiaFemaleNeurology (clinical)Intracranial Thrombosisbusiness030217 neurology & neurosurgery
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Insight into epileptic and physiological déjà vu: from a multicentric cohort study

2019

Background and purpose The presence of a continuum between physiological deja vu (DV) and epileptic DV is still not known as well as epidemiological data in the Italian population. The aim was to identify the epidemiological distribution of DV in Italy, and secondly to look for specific features of DV able to discriminate between epileptic and non-epileptic DV. Methods In all, 1000 individuals, 543 healthy controls (C) (313 women; age 40 ± 15 years) and 457 patients with epilepsy (E) (260 women; age 39 ± 14 years), were prospectively recruited from 10 outpatient neurological clinics throughout Italy. All populations were screened using the Italian Inventory for Deja Vu Experiences Assessmen…

AdultMalemedicine.medical_specialtymedia_common.quotation_subjectNeurocognitive Disordersepilepsy; epileptic déjà vu; physiological déjà vu; Adult; Cohort Studies; Epilepsy; Female; Humans; Italy; Male; Middle Aged; Neurocognitive Disorders; Recognition Psychology; Deja VuCohort Studies03 medical and health sciencesEpilepsy0302 clinical medicineEpidemiologyHumansPsychologyMedicine030212 general & internal medicinePsychiatrymedia_commonbusiness.industryphysiological déjà vuRecognition PsychologyMiddle AgedDeja Vumedicine.diseaseItalian populationepileptic déjà vuRecognitionItalyNeurologyFeelingDéjà vuEtiologyepilepsyFemaleNeurology (clinical)Epileptic seizuremedicine.symptombusiness030217 neurology & neurosurgeryCohort study
researchProduct

Rapid-rate transcranial magnetic stimulation of left dorsolateral prefrontal cortex in drug-resistant depression.

1996

Summary Background Lesion and neuroimaging studies suggest that left prefrontal lobe dysfunction is pathophysiologically linked to depression. Rapid-rate transcranial magnetic stimulation (rTMS) to prefrontal structures has a lateralised effect on mood in normal volunteers, and several preliminary studies suggest a beneficial effect of rTMS on depression. However, adequately controlled studies have not been conducted. Methods We have studied the effects of focal rTMS on the depressive symptoms in 17 patients with medication-resistant depression of psychotic subtype. The study was designed as a multiple cross-over, randomised placebo-controlled trial. Sham rTMS and stimulation of different c…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentDrug ResistancePrefrontal CortexStimulationElectric Stimulation TherapyAudiologybehavioral disciplines and activitiesElectroconvulsive therapyNeuroimagingSurveys and Questionnairesmental disordersmedicineHumansPsychiatryPrefrontal cortexDepression (differential diagnoses)Depressive DisorderCross-Over Studiesbusiness.industryGeneral MedicineMiddle AgedTranscranial Magnetic StimulationTranscranial magnetic stimulationMoodMagnetic seizure therapyFemalebusinessLancet (London, England)
researchProduct

Degree of Postictal Suppression Depends on Seizure Induction Time in Magnetic Seizure Therapy and Electroconvulsive Therapy.

2017

OBJECTIVES Anesthesia is required for both magnetic seizure therapy (MST) and electroconvulsive therapy (ECT), although it has anticonvulsant properties. In this case, bispectral index (BIS) monitoring, a specific electroencephalogram-derived monitoring, can be used to find the optimal seizure induction time during anesthesia to elicit adequate seizures. A measurement of seizure adequacy in electroencephalogram is the postictal suppression. The purpose of this study was to investigate the influence of seizure induction time on the degree of postictal suppression by comparing BIS versus no-BIS monitoring in MST and ECT. METHODS Twenty patients with treatment-resistant depression were randoml…

AdultMalemedicine.medical_treatmentNeuroscience (miscellaneous)law.invention03 medical and health sciencesDepressive Disorder Treatment-Resistant0302 clinical medicineElectroconvulsive therapyConsciousness MonitorsElectromagnetic FieldsRandomized controlled triallawPredictive Value of TestsSeizuresmedicineHumansAnesthesiaProspective StudiesElectroconvulsive TherapyAgedPsychiatric Status Rating ScalesCross-Over Studiesbusiness.industryElectroencephalographyMiddle AgedCrossover study030227 psychiatryPsychiatry and Mental healthAnticonvulsantTreatment OutcomeMagnetic seizure therapyBispectral indexAnesthesiaBrain stimulationFemaleAnalysis of variancebusinesshuman activities030217 neurology & neurosurgeryThe journal of ECT
researchProduct

Ictal functional TCD for the lateralization of the seizure onset zone—a report of two cases

2004

Ictal functional transcranial Doppler sonography (I-fTCD) was used to lateralize the ictal onset zone in the presurgical evaluation of two patients with temporal lobe epilepsy. In one patient, I-fTCD and ictal SPECT were performed simultaneously during EEG-monitoring. In both patients, results were concordant with the ictal SPECT findings, PET and semiology. I-fTCD seems to be an interesting new method to non-invasively lateralize the seizure onset zone with high temporal resolution. I-fTCD and SPECT may give complementary information to lateralize the seizure onset zone.

AdultMiddle Cerebral Arterymedicine.medical_specialtyUltrasonography Doppler TranscranialElectroencephalographyIctal-Interictal SPECT Analysis by SPMFunctional LateralityNeurosurgical ProceduresLateralization of brain functionTemporal lobeCentral nervous system diseaseEpilepsySeizuresmedicineHumansIctalTomography Emission-Computed Single-Photonmedicine.diagnostic_testbusiness.industryElectroencephalographySemiologymedicine.diseasenervous system diseasesEpilepsy Temporal Lobenervous systemNeurologyAnesthesiaFemaleNeurology (clinical)RadiologybusinessEpilepsy Research
researchProduct

Soothing the seizures of children.

2008

Endocannabinoids are versatile molecules, regulating a variety of functions in the body. Daniele Piomelli explores how recent clinical trials testing rimonabant, an inhibitor of endocannabinoid signaling, for weight loss emerged from studies of individuals with schizophrenia; such trials have spurred basic research into how endocannabinoids affect both energy use and mood. Beat Lutz and Krisztina Monory examine how rimonabant might prove useful for preventing the development of adult epilepsy in response to fever-induced seizures in infants and young children.

AdultModels NeurologicalGeneral Biochemistry Genetics and Molecular BiologySeizures FebrileEpilepsyRimonabantPiperidinesBasic researchWeight lossCannabinoid Receptor ModulatorsmedicineHumansCannabinoid Receptor AntagonistsClinical Trials as TopicEpilepsybusiness.industryGeneral Medicinemedicine.diseaseEndocannabinoid systemClinical trialMoodChild PreschoolCannabinoid receptor antagonistPyrazoleslipids (amino acids peptides and proteins)medicine.symptomRimonabantbusinessNeurosciencemedicine.drugNature medicine
researchProduct

An increase of hippocampal calretinin-immunoreactive neurons correlates with early febrile seizures in temporal lobe epilepsy

1999

Numerous studies indicate that initial precipi- tating injuries (IPI) such as febrile seizures during early childhood may play a pivotal role in the pathogenesis of temporal lobe epilepsy (TLE) and Ammon's horn sclero- sis (AHS). Previous data demonstrate an increase of hori- zontally oriented neurons in molecular layers of hip- pocampal subfields, which are immunoreactive for calre- tinin (CR-ir) and resemble Cajal-Retzius-like cells. Cajal- Retzius cells are transiently expressed in the murine de- veloping hippocampus and are critically involved in neu- ronal pattern formation. Here we investigated a potential relationship between the distribution of horizontally ori- ented calretinin-imm…

AdultPathologymedicine.medical_specialtyAdolescentHippocampusNerve Tissue ProteinsHippocampal formationHippocampusSeizures FebrilePathology and Forensic MedicineTemporal lobeCellular and Molecular NeuroscienceEpilepsyS100 Calcium Binding Protein GmedicineNeuropilHumansNeuronsSclerosisbusiness.industryDentate gyrusAge FactorsAnatomyMiddle Agedmedicine.diseaseGranule cellImmunohistochemistrymedicine.anatomical_structureEpilepsy Temporal Lobenervous systemCalbindin 2Neurology (clinical)CalretininbusinessActa Neuropathologica
researchProduct

Bimodal sensory stimulation-induced seizures.

1987

Abstract A curious case is reported in which the patient, a young woman, exibited convulsive seizures when approaching closely to a television. The visual and acoustic stimulation did not change her EEG, whereas simultaneous stimulation with both the modalities induced bilateral and symmetrical high-voltage spikes (with their diffusion) that led to a convulsive seizure. Results are discussed with relation to the literature.

AdultSensory stimulation therapymedicine.diagnostic_testStimulationElectroencephalographyGeneral MedicineElectroencephalographyConvulsive seizureSimultaneous stimulationConvulsive SeizuresNeurologyAcoustic StimulationSeizuresmedicineHumansFemaleTelevisionsense organsNeurology (clinical)PsychologyNeurosciencePhotic StimulationActa neurologica Scandinavica
researchProduct

Association of a CB1 Cannabinoid Receptor Gene (CNR1) polymorphism with severe alcohol dependence

2002

Abstract Due to the involvement of the endogenous cannabinoid system in brain reward mechanisms a silent polymorphism (1359G/A; Thr453Thr) in the single coding exon of the CB1 human cannabinoid receptor gene ( CNR1 ) was analysed in 121 severely affected Caucasian alcoholics and 136 most likely non-alcoholic controls. The observed frequency of the A allele was 31.2% for controls and 42.1% for alcoholics with severe withdrawal syndromes ( P =0.010). Post-hoc exploration indicated that this allelic association resulted from an excess of the homozygous A/A genotype in patients with a history of alcohol delirium ( P =0.031, DF 2), suggesting s an increased risk of delirium (OR=2.45, 95% CI 1.14…

Adultmedicine.medical_specialtyCannabinoid receptorGenotypeReceptors DrugToxicologyAlcohol Withdrawal SeizuresAlcohol Withdrawal DeliriumExonRisk FactorsPolymorphism (computer science)Internal medicinemental disordersGenotypemedicineHumansPharmacology (medical)AlleleReceptors CannabinoidPharmacologyPolymorphism Geneticbusiness.industryAlcohol Withdrawal DeliriumAlcoholismPsychiatry and Mental healthEndocrinologyDeliriumBrain stimulation rewardmedicine.symptombusinessDrug and Alcohol Dependence
researchProduct