Search results for "Statistic"

showing 10 items of 12520 documents

GLAM ORGANIZATIONS’ DIGITAL MATURITY INDICATOR: A STATISTICAL APPROACH FOR CAMPANIA MUSEUMS

2019

Digital Maturity is a complex phenomenon, involving vertical as well as horizontal processes throughout firms. Therefore, the use of multidimensional tools represents the most appropriate approach in measuring companies’ digital transformation status (Chanias and Hess, 2016). In recent years, Digital Maturity Models (DMMs)were developed in order to get a current measure of an organization’s as-is digital capability (Deloitte, 2018). However, DMMs’ effectiveness relies purely on raw data without taking into account items’ different difficulties. Moreover, though the vast majority of digital maturity models are mainly focused on manufacturing based organizations, an understanding of the chall…

digital museums cultural heritage Rasch modelSettore SECS-S/05 - Statistica Socialecultural heritageSettore SECS-S/01 - Statisticadigital museumsRasch model
researchProduct

Beyond Tandem Analysis: Joint Dimension Reduction and Clustering in R

2019

We present the R package clustrd which implements a class of methods that combine dimension reduction and clustering of continuous or categorical data. In particular, for continuous data, the package contains implementations of factorial K-means and reduced K-means; both methods combine principal component analysis with K-means clustering. For categorical data, the package provides MCA K-means, i-FCB and cluster correspondence analysis, which combine multiple correspondence analysis with K-means. Two examples on real data sets are provided to illustrate the usage of the main functions.

dimension reduction; clustering; principal component analysis; multiple correspondence analysis; K-meansStatistics and Probabilitydimension reduction clustering principal component analysis multiple correspon-dence analysis K-meansFactorialmultiple correspon-dence analysisMultiple correspondence analysiComputer sciencedimension reductionprincipal component analysisk-meansmultiple correspondence analysisPrincipal component analysicomputer.software_genre01 natural sciencesCorrespondence analysis010104 statistics & probabilityMultiple correspondence analysis0101 mathematicsCluster analysisCategorical variablelcsh:Statisticslcsh:HA1-4737Dimensionality reductionk-means clusteringK-meanPrincipal component analysisData miningHA29-32Statistics Probability and UncertaintycomputerSoftwareclusteringJournal of Statistical Software
researchProduct

La scuola è uguale per tutti? Alcune riflessioni sull’istruzione in Italia a 55 anni dalla Scuola di Barbiana.

2021

Il lavoro percorre le tappe dell'istruzione italiana dal dopoguerra ad oggi puntando l'attenzione sulle diseguaglianze presenti nella scuola secondaria e all'università

diseguaglianza scuola secondaria università BarbianaSettore SECS-S/05 - Statistica Sociale
researchProduct

Scomposizione della disuguaglianza socio-economica della salute: analisi dei dati EU-SILC 2010 sulle condizioni di vita delle famiglie

disuguaglianza della salute indice di concentrazioneSettore MED/01 - Statistica Medica
researchProduct

Elementi per una analisi dei divari regionali tra le regioni italiane

2008

divari territoriali mercato bancarioSettore SECS-S/03 - Statistica Economica
researchProduct

Territori e contesti dello sviluppo economico: dati e tecniche statistiche in un approccio storico

2022

Questo volume raccoglie alcuni studi e ricerche storiche che evidenziano il ruolo del territorio e dei contesti spaziali per la promozione dello sviluppo economico e sociale. L'approccio è per l'appunto storico, cioè riferito a dati e contesti di analisi tra i decenni 1990 e 2000 al fine di meglio comprendere alcuni aspetti della realtà economica italiana del recente passato e quale ulteriore base di riflessione della mancata crescita e produttività del nostro Paese.

divari territoriali sviluppo economico statistica economicaSettore SECS-S/03 - Statistica Economica
researchProduct

Nonlinear Time-Series Adaptation for Land Cover Classification

2017

Automatic land cover classification from satellite image time series is of paramount relevance to assess vegetation and crop status, with important implications in agriculture, biofuels, and food. However, due to the high cost and human resources needed to characterize and classify land cover through field campaigns, a recurrent limiting factor is the lack of available labeled data. On top of this, the biophysical–geophysical variables exhibit particular temporal structures that need to be exploited. Land cover classification based on image time series is very complex because of the data manifold distortions through time. We propose the use of the kernel manifold alignment (KEMA) method for…

domain adaptationComputer science0211 other engineering and technologies02 engineering and technologyLand coverNormalized Difference Vegetation IndexVegetation coverkernel methods0202 electrical engineering electronic engineering information engineeringElectrical and Electronic EngineeringTime series021101 geological & geomatics engineeringRemote sensingManifold alignment[SHS.STAT]Humanities and Social Sciences/Methods and statisticsbusiness.industryVegetation15. Life on landGeotechnical Engineering and Engineering GeologyKernel methodKernel (image processing)Agriculturemanifold alignment020201 artificial intelligence & image processingSatellite Image Time SeriesLand cover classificationtime seriesScale (map)businessIEEE Geoscience and Remote Sensing Letters
researchProduct

Studying the double-frequency heating mode in ECRIS plasma using Kα diagnostics

2018

Despite the success of double-heating frequency in enhancing high charge state production, the underlying physics remains poorly understood. By combining three different diagnostic techniques i.e. Kα emission, optical emission and the extracted charge state distribution, it is now possible to assess the proposed explanations for the effectiveness of double-frequency heating against the experimental results. These results seem to indicate that the increase of plasma density accounts largely for the favorable behavior of this operation mode compared to single-frequency mode. peerReviewed

double-heating frequencyMaterials scienceta114syklotronitemissionMode (statistics)PlasmaAtomic physicsDouble frequencyplasmafysiikkaplasmaplasma (kaasut)emissio (fysiikka)
researchProduct

Refining distraction potential testing guidelines by considering differences in glancing behavior

2021

Driver distraction is a recognized cause of traffic accidents. Although the well-known guidelines for measuring distraction of secondary in-car tasks were published by the United States National Highway Traffic Safety Administration (NHTSA) in 2013, studies have raised concerns on the accuracy of the method defined in the guidelines, namely criticizing them for basing the diversity of the driver sample on driver age, and for inconsistent between-group results. In fact, it was recently discovered that the NHTSA driving simulator test is susceptible to rather fortuitous results when the participant sample is randomized. This suggests that the results of said test are highly dependent on the s…

driver distractionvisual distractionocclusion distanceComputer scienceApplied psychologyTransportationSample (statistics)driver inattentionhäiriötDistraction0502 economics and business0501 psychology and cognitive sciencesEmpirical evidenceSet (psychology)distraction potential testingindividual differences050107 human factorsApplied PsychologyCivil and Structural Engineering050210 logistics & transportation05 social sciencesDriving simulatorkeskittymiskykyautoilijatTest (assessment)Display sizetestausmenetelmätAutomotive Engineeringkatseenseuranta
researchProduct

SURCOTES MARINES DANS LE GOLFE DU LION ET FORCAGES ATMOSPHERIQUES : VARIABILITE CONTEMPORAINE ET FUTURE (1950-2100)

2010

Sea surges in the Gulf of Lions are mainly forced by southerly and south-easterly winds. This regional-scale atmospheric circulation is leading by a strong zonal gradient between low pressure system over the Bay of Biscay and high pressure over central Europe. This synoptic-scale circulation mostly happens during “Greenland Above” weather regime. In the second half of the 20th century, a slow increase of the sea-level pressure over central Europe increased the probability of having “Greenland Above” weather types associated with a southerly atmospheric circulation in the Gulf of Lions, thus leading to strong surges. A linear regression is used to simulate the interannual variability of high…

désagrégation d'échellechangement climatique"Golfe du Lion"[SDE.MCG]Environmental Sciences/Global Changes[SHS.GEO] Humanities and Social Sciences/Geography"weather regimes""Gulf of Lion"[SHS.GEO]Humanities and Social Sciences/Geography"sea surges""statistical downscaling"surcotes[ SHS.GEO ] Humanities and Social Sciences/Geography"surcotes"[ SDE.MCG ] Environmental Sciences/Global Changes"désagrégation d'échelle"[SDE.MCG] Environmental Sciences/Global Changes[SDU.STU.CL] Sciences of the Universe [physics]/Earth Sciences/Climatology[SDU.STU.CL]Sciences of the Universe [physics]/Earth Sciences/ClimatologyGolfe du Lion"changement climatique"[ SDU.STU.CL ] Sciences of the Universe [physics]/Earth Sciences/Climatology" type de temps""climate change"type de temps
researchProduct