Search results for "Surveillance"

showing 10 items of 494 documents

ADMA, subclinical changes and atrial fibrillation in the general population.

2015

Abstract Background Pathways of oxidative stress, nitric oxide bioavailability and l-arginine derivatives are hypothesized to be related to atrial fibrillation (AF). Circulating methylated l-arginine metabolites can be assessed in the general population and may show an association with AF. Methods We determined l-arginine and its metabolites asymmetric dimethylarginine (ADMA), l-N ω -monomethylarginine (NMMA) and symmetric dimethylarginine (SDMA) in the population-based Gutenberg Health Study (n=5000), mean age 55±11years, 51% men, in association with clinical variables of AF such as electrocardiographic and echocardiographic measures and manifest AF. Results Individuals with AF (N=161), 71…

AdultMalemedicine.medical_specialtyPopulation030204 cardiovascular system & hematologyArginine03 medical and health scienceschemistry.chemical_compoundQRS complexElectrocardiography0302 clinical medicineTandem Mass SpectrometryInternal medicineGermanyAtrial FibrillationmedicineHumanseducationAgedCreatinineeducation.field_of_studyomega-N-Methylargininebusiness.industryAtrial fibrillationOdds ratioMiddle Agedmedicine.diseaseConfidence interval3. Good healthOxidative StressEndocrinologychemistryEchocardiographyPopulation SurveillanceCardiologyOmega-N-MethylarginineFemaleMorbidityCardiology and Cardiovascular MedicineAsymmetric dimethylargininebusiness030217 neurology & neurosurgeryBiomarkersChromatography LiquidInternational journal of cardiology
researchProduct

The P300 event-related potential and smoking--a population-based case-control study.

2009

A better understanding of the factors underlying habitual tobacco smoking may further new strategies to go about this major health problem. The P300 event-related potential (ERP) has emerged as a valuable (endo)phenotype in neuropsychiatric research. Previous studies suggested the P300 ERP to be reduced in smokers. The main purpose of the present study was to provide an in-depth description of smoking-related behavioral, biological and electrophysiological phenotypes with an emphasis on the P300 ERP and its mutual relationship with other smoking-related parameters. In this case-control study N=1318 participants (smokers and never-smoking controls) were investigated at 6 German academic inst…

AdultMalemedicine.medical_specialtyPopulationNicotineYoung AdultEvent-related potentialPhysiology (medical)medicineHumansYoung adulteducationPsychiatryeducation.field_of_studyGeneral NeuroscienceConfoundingSmokingCase-control studyCognitionElectroencephalographyMiddle Agedmedicine.diseaseEvent-Related Potentials P300Substance abuseNeuropsychology and Physiological PsychologyCase-Control StudiesPopulation SurveillanceFemalePsychologymedicine.drugInternational journal of psychophysiology : official journal of the International Organization of Psychophysiology
researchProduct

The KARTAN study: a postmarketing assessment of Irbesartan in patients with hypertension.

2004

An important purpose of postmarketing surveillance of drugs is to better characterize the safety profile of drug therapy in the clinical setting. Another goal is to confirm the effectiveness of these drugs in patients who are candidates for antihypertensive therapy and who may have been excluded from Phase III studies. Irbesartan is a long-acting angiotensin II-receptor blocker specific for the angiotensin 1-receptor subtype that, in clinical trials in patients with hypertension, reduces blood pressure.The KARTAN (this word was derived from the first and last syllables of Karvea [trademark of Bristol-Myers Squibb Group, Madrid, Spain] and irbesartan) study was designed to confirm and extend…

AdultMalemedicine.medical_specialtyPostmarketing surveillanceTetrazolesBlood PressurePharmacologyIrbesartanHeart RateRisk FactorsInternal medicinemedicineProduct Surveillance PostmarketingHumansPharmacology (medical)Prospective cohort studyAntihypertensive AgentsAgedPharmacologyAged 80 and overbusiness.industryBiphenyl CompoundsIrbesartanMiddle AgedAngiotensin IIClinical trialBlood pressureTolerabilitySpainHypertensionObservational studyFemalebusinessmedicine.drugClinical therapeutics
researchProduct

Subtype-specific incidence of testicular cancer in Germany: a pooled analysis of nine population-based cancer registries.

2009

Summary Comparisons of incidence estimates of testicular cancer subtypes beyond seminoma and non-seminoma are virtually missing in the epidemiologic literature. We analysed incidence data from population-based German cancer registries to provide subtype-specific incidences of testicular cancer. We pooled data from nine cancer registries from 1998 to 2003. We estimated incidence and mortality time trends of West and East Germany. Incidence and mortality were standardized by the European standard population. The annual percentage incidence change from 1961 through 1989 was 4.9% in East Germany and 3.0% from 1970 through 2004 in Saarland. Incidence increases were the most pronounced among adol…

AdultMalemedicine.medical_specialtyTime Factorsendocrine system diseasesAdolescentUrologyEndocrinology Diabetes and MetabolismPopulationPopulation basedEmbryonal carcinomaYoung AdultAge DistributionTesticular NeoplasmsCarcinoma EmbryonalGermanymedicineHumansChoriocarcinomaRegistrieseducationChildTesticular cancerAgedGynecologyAged 80 and overeducation.field_of_studybusiness.industryIncidence (epidemiology)IncidenceInfant NewbornTeratomaCancerInfantSeminomaMiddle Agedmedicine.diseaseSeminomaReproductive MedicineTesticular LymphomaChild PreschoolPopulation SurveillancebusinessDemographyInternational journal of andrology
researchProduct

Invasive fungal disease in patients undergoing umbilical cord blood transplantation after myeloablative conditioning regimen

2018

OBJECTIVE Characteristics and risk factors (RFs) of invasive fungal disease (IFD) have been little studied in the setting of umbilical cord blood transplantation (UCBT). METHOD We retrospectively included 205 single-unit myeloablative UCBT recipients with a median follow-up of 64 months. RESULTS Fifty-six episodes of IFD were observed in 48 patients (23%) at a median time of 123 days after stem cell infusion. Invasive mold disease (IMD) occurred in 42 cases, 38 of them (90%) caused by invasive aspergillosis whereas invasive yeast disease (IYD) occurred in 14 cases, most of them due to candidemia (n = 12, 86%). The 5-year cumulative incidence of IFD, IMDs, and IYDs was 24% 19%, and 7%, respe…

AdultMalemedicine.medical_specialtyTransplantation ConditioningMultivariate analysisAdolescentGraft vs Host DiseaseDiseaseAspergillosisSeverity of Illness IndexGastroenterologyYoung Adult03 medical and health sciences0302 clinical medicineAnti-Infective AgentsRisk FactorsCause of DeathInternal medicinemedicineHumansPublic Health SurveillanceCumulative incidenceRetrospective Studiesbusiness.industryUmbilical Cord Blood TransplantationIncidenceHematologyGeneral MedicineMiddle Agedmedicine.diseasePatient Outcome AssessmentGraft-versus-host diseaseMycoses030220 oncology & carcinogenesisFemaleCord Blood Stem Cell TransplantationStem cellComplicationbusiness030215 immunologyEuropean Journal of Haematology
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Defining a reference population to determine the 99th percentile of a contemporary sensitive cardiac troponin I assay

2013

Abstract Background Diagnosis of acute myocardial infarction (AMI) according to the universal definition is based on ischemic symptoms, imaging findings and elevated myocardial necrosis markers, preferably cardiac troponin I/T with diagnostic threshold representing the 99th percentile of a reference population. It is not clearly defined if this should be an unselected population-based or a healthy cohort with respect to cardiac diseases. Aim of the current study was to describe the distribution of troponin I using a sensitive assay and to evaluate the impact of cardiac diseases and cardiovascular risk factors in apparently healthy individuals. Methods Troponin I was determined using a conte…

AdultMalemedicine.medical_specialtymedicine.drug_classPopulationDiseaseCohort StudiesSex FactorsReference ValuesRisk FactorsInternal medicineTroponin INatriuretic peptidemedicineHumansProspective StudiesMyocardial infarctioneducationAgededucation.field_of_studybusiness.industryTroponin IAge FactorsMiddle Agedmedicine.diseaseSurgeryCross-Sectional StudiesCardiovascular DiseasesPopulation SurveillanceCohortCardiologyPopulation studyFemaleCardiology and Cardiovascular MedicinebusinessBiomarkersCohort studyInternational Journal of Cardiology
researchProduct

Primary HBB gene mutation severity and long-term outcomes in a global cohort of β-thalassaemia

2021

In β-thalassaemia, the severity of inherited β-globin gene mutations determines the severity of the clinical phenotype at presentation and subsequent transfusion requirements. However, data on associated long-term outcomes remain limited. We analysed data from 2109 β-thalassaemia patients with available genotypes in a global database. Genotype severity was grouped as β0 /β0 , β0 /β+ , β+ /β+ , β0 /β++ , β+ /β++ , and β++ /β++ . Patients were followed from birth until death or loss to follow-up. The median follow-up time was 34·1 years. Mortality and multiple morbidity outcomes were analyzed through five different stratification models of genotype severity groups. Interestingly, β0 and β+ mu…

AdultMalemedicine.medical_specialtyphenotypegenotypemorbidityKaplan-Meier Estimatebeta-GlobinsGene mutationβ thalassaemiaGlobal HealthGastroenterologySeverity of Illness IndexsurvivalCohort StudiesYoung AdultInternal medicineGenotypemedicineLong term outcomesOdds RatioHumansAllelesgenotype; morbidity; mortality; phenotype; survivalProportional Hazards Modelsbusiness.industrybeta-ThalassemiaDisease ManagementHematologyPrognosisPhenotypemortalityConfidence intervalPopulation SurveillanceCohortMutationFemaleRisk of deathbusinessFollow-Up Studies
researchProduct

A study protocol for applying the co-creating knowledge translation framework to a population health study

2013

Background: Population health research can generate significant outcomes for communities, while Knowledge Translation (KT) aims to expressly maximize the outcomes of knowledge producing activity. Yet the two approaches are seldom explicitly combined as part of the research process. A population health study in Port Lincoln, South Australia offered the opportunity to develop and apply the co-KT Framework to the entire research process. This is a new framework to facilitate knowledge formation collaboratively between researchers and communities throughout a research to intervention implementation process. Design: This study employs a five step framework (the co-KT Framework) that is formulate…

AdultRural PopulationKnowledge managementAdolescentParticipatory action researchHealth InformaticsKnowledge frameworkKnowledge creationKnowledge translationTranslational Research BiomedicalStudy ProtocolYoung Adult03 medical and health sciences0302 clinical medicineNursingKnowledge translationSouth AustraliaHumansMedicine030212 general & internal medicineAction researchChildHealth policyAgedMedicine(all)business.industry030503 health policy & servicesHealth PolicyPopulation healthPublic Health Environmental and Occupational HealthHealth services researchInfantGeneral MedicineMiddle AgedKnowledge baseResearch DesignChild PreschoolPopulation SurveillanceCommunity healthKnowledge translation modelCommunity health0305 other medical sciencebusinessAction researchEngaged scholarshipImplementation Science
researchProduct

Maternal and Neonatal Characteristics for Late Foetal Death in Latvia between 2001 and 2014: Population-Based Study

2018

Introduction. Stillbirth is one of the most common adverse pregnancy outcomes worldwide. Late foetal death (LFD) rates are mostly used for international comparisons because of the large variations in stillbirth rates between countries. Objective. To examine trends in LFD (including antepartum and intrapartum) by multiple births, birth weight, and maternal age in two time periods. Methods. A retrospective cohort study was used to analyse data from the Medical Birth Register (2001–2014), divided into 2 periods of 7 years each. In total, data on 1,340 singletons were analysed. This study calculated LFD rates and rate ratios (RR). Results. The overall LFD rate showed a slight statistically sign…

Adultmedicine.medical_specialtyArticle SubjectBirth weightGestational Agelcsh:Gynecology and obstetricsYoung Adult03 medical and health sciences0302 clinical medicinePregnancyRisk FactorsmedicineFoetal deathBirth WeightHumansRegistries030212 general & internal medicineYoung adultlcsh:RG1-991reproductive and urinary physiologyRetrospective StudiesPregnancyChi-Square Distribution030219 obstetrics & reproductive medicineObstetricsbusiness.industryMortality rateInfant Newbornfood and beveragesObstetrics and GynecologyGestational agePrenatal CareRetrospective cohort studyStillbirthmedicine.diseaseLatviafemale genital diseases and pregnancy complicationsPopulation SurveillancePremature BirthFemalebusinessChi-squared distributionResearch ArticleJournal of Pregnancy
researchProduct