Search results for "THERMAL"

showing 10 items of 3576 documents

The 3D structure of fabric and its relationship to liquid and vapor transport

2004

Polymeric carrier fabrics are commonly used in many industrial processes including manufacture of paper and board. Apart from acting as a carrier for the compressible porous material during the manufacturing process, the synthetic woven fabrics comprising mainly of poly ethylene terypthalate (PET) yarns, impart valuable product attributes, i.e. softness, bulk, absorbency, etc. in consumer products. The three-dimensional structure of the fabrics plays a critical role in deciding the manufacturing and energy efficiency as well as product end-use properties. X-ray micro computed tomography (X-CT) provides a non-intrusive technique to visualize and analyze the three-dimensional structure of por…

/dk/atira/pure/sustainabledevelopmentgoals/affordable_and_clean_energyChemistryPapermakingNanotechnologyThermal diffusivityTortuosityPermeability (earth sciences)Colloid and Surface ChemistryFluid dynamicsSDG 7 - Affordable and Clean EnergyDiffusion (business)Composite materialPorous mediumPorosityColloids and Surfaces A: Physicochemical and Engineering Aspects
researchProduct

Derivation of a Homogenized Two-Temperature Model from the Heat Equation

2014

This work studies the heat equation in a two-phase material with spherical inclusions. Under some appropriate scaling on the size, volume fraction and heat capacity of the inclusions, we derive a coupled system of partial differential equations governing the evolution of the temperature of each phase at a macroscopic level of description. The coupling terms describing the exchange of heat between the phases are obtained by using homogenization techniques originating from [D. Cioranescu, F. Murat: Coll\`ege de France Seminar vol. 2. (Paris 1979-1980) Res. Notes in Math. vol. 60, pp. 98-138. Pitman, Boston, London, 1982.]

01 natural sciencesHomogenization (chemistry)Heat capacity010305 fluids & plasmasTwo temperatureMathematics - Analysis of PDEsThermal nonequilibrium models0103 physical sciencesFOS: Mathematics[MATH.MATH-AP]Mathematics [math]/Analysis of PDEs [math.AP]0101 mathematicsScalingMSC 35K05 35B2776T05 (35Q79 76M50)35K05 35B27 76T05 (35Q79 76M50)MathematicsNumerical AnalysisHomogenizationPartial differential equationInfinite diffusion limitApplied MathematicsHeat equationMathematical analysis010101 applied mathematicsComputational MathematicsThermal non-equilibrium modelsModeling and SimulationVolume fractionHeat equationAnalysisAnalysis of PDEs (math.AP)
researchProduct

Migration kinetics of ion-implanted beryllium in glassy carbon

2008

Abstract Migration kinetics of low-concentration implanted 7 Be in glassy carbon has been studied by the modified radiotracer technique at temperatures 1285 °C and 1340 °C. The annealed sample concentration profiles show two distinctive components: (i) Main profile broadening assigned to beryllium trapping in defects during annealing. (ii) Tail parts on both sides of the profile maximum related to faster migration. Of the latter the profile representing bulk diffusion lies on the region free of defect influence and is well described by concentration-independent diffusivity. The features of the concentration profile broadening towards the sample surface indicate partial Be trapping in defect…

010302 applied physicsAnnealing (metallurgy)Mechanical EngineeringAnalytical chemistrychemistry.chemical_elementDiamond02 engineering and technologyGeneral ChemistryTrappingengineering.materialGlassy carbon021001 nanoscience & nanotechnologyThermal diffusivity01 natural sciencesElectronic Optical and Magnetic MaterialsIonchemistryImpurity0103 physical sciencesMaterials ChemistryengineeringElectrical and Electronic EngineeringBeryllium0210 nano-technologyDiamond and Related Materials
researchProduct

Batch-to-Melt Conversion Kinetics in Sodium Aluminosilicate Batches Using Different Alumina Raw Materials

2016

The batch-to-melt conversion in batches of sand, soda ash and corundum (C), alumina spinel (A), boehmite (B), or gibbsite (G) as Al2O3 carrier are studied using thermal analysis, X-ray diffraction, and 27Al nuclear magnetic resonance spectroscopy. Laboratory-scaled batches are either heated continuously or quenched from 1600°C in a series of increasing dwell times. The results show that the conversion from the raw materials to the fresh melt proceeds in two kinetic stages. During the first stage (3–5 min), fast conversion of nearly 95% by mass occurs and the conversion coefficient increases in the order G < C ≈ A < B. The second stage is controlled by the slow dissolution of intermediate cr…

010302 applied physicsBoehmiteMaterials scienceSpinelAnalytical chemistryMineralogyCorundum02 engineering and technologyengineering.material021001 nanoscience & nanotechnology01 natural sciencesCristobalitechemistry.chemical_compoundchemistry0103 physical sciencesengineeringGeneral Materials Science0210 nano-technologyThermal analysisDissolutionGibbsiteSodium aluminosilicateInternational Journal of Applied Glass Science
researchProduct

Tailoring the anomalous Hall effect of SrRuO$_3$ thin films by strain: a first principles study

2021

Motivated by the recently observed unconventional Hall effect in ultra-thin films of ferromagnetic SrRuO$_3$ (SRO) we investigate the effect of strain-induced oxygen octahedral distortion in the electronic structure and anomalous Hall response of the SRO ultra-thin films by virtue of density functional theory calculations. Our findings reveal that the ferromagnetic SRO films grown on SrTiO$_3$ (in-plane strain of $-$0.47$\%$) have an orthorhombic (both tilting and rotation) distorted structure and with an increasing amount of substrate-induced compressive strain the octahedral tilting angle is found to be suppressed gradually, with SRO films grown on NdGaO$_3$ (in-plane strain of $-$1.7$\%$…

010302 applied physicsCondensed Matter - Materials ScienceMaterials scienceCondensed matter physicseducationGeneral Physics and AstronomyThermal fluctuationsMaterials Science (cond-mat.mtrl-sci)FOS: Physical sciences02 engineering and technologyElectronic structure021001 nanoscience & nanotechnology01 natural sciencesTetragonal crystal systemMagnetizationCondensed Matter::Materials ScienceFerromagnetismHall effect0103 physical sciencesddc:530Orthorhombic crystal systemBerry connection and curvature0210 nano-technology
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Experimental Equipment for Studying the Residual Stresses Developed During High Temperature Reactions by X-Ray Diffraction

1996

This paper describes a device dedicated to studyng, by X-ray diffraction the residual stresses developed on surface samples as a function of temperature and atmosphere conditions. The setup consists of : a.) an horizontal axis goniometer which allows the programmed positionning of the sealed X-ray source and of the linear detector. b.) a high temperature controlled atmosphere chamber Particular attention has been paid to the thermal stability up to 1200°C and the accurate position on the sample.

010302 applied physicsDiffractionControlled atmosphereChemistrybusiness.industryDetectorGeneral Physics and Astronomy02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesAtmosphereOpticsResidual stressGoniometer[PHYS.HIST]Physics [physics]/Physics archives0103 physical sciencesX-ray crystallographyThermal stability0210 nano-technologybusiness
researchProduct

Review of space charge measurement systems: acoustic, thermal and optical methods

2016

In the last decade, remarkable developments have concerned the methods of space charge measurement in the field of insulation systems diagnostic. In particular, methods based on acoustic and thermal phenomena have been largely used. The present review provides a broad overview on the different techniques used describing, for each of them, the working principle, the main features and the most relevant applications. Further details are provided for the Pulsed Electro-Acoustic (PEA) method, as it seems to be the most used. This article provides more details on its historical evolution, showing evidence for its technological limits and taking into consideration the advantages and drawn from the…

010302 applied physicsEngineeringField (physics)business.industry020209 energySystem of measurementMechanical engineering02 engineering and technology01 natural sciencesSpace chargeSettore ING-IND/31 - ElettrotecnicaSpace charge Charge measurement Acoustics Optical variables measurement Electrodes Acoustic measurements Optical pulses0103 physical sciencesThermal0202 electrical engineering electronic engineering information engineeringElectrical and Electronic EngineeringbusinessThermal methodsIEEE Transactions on Dielectrics and Electrical Insulation
researchProduct

A Magnetohydrodynamic Auxiliary Propulsion system for docking assistance of autonomous vehicle

2016

In this article we present an approach to the description of Magnetohydrodynamic Auxiliary Propulsion system for docking assistance of autonomous vehicle. Preliminarily, an analytical model which includes an electromagnetic model and a thermal model is presented. Successively, in order to move beyond the analytical model, a 3-D MHD modeling tool and a Runge Kutta method based solver are presented and they are used to investigate an alternative MHD solutions. Some numerical analysis are given

010302 applied physicsEngineeringbusiness.industryNumerical analysis05 social sciencesControl engineeringOcean EngineeringSolverPropulsionSettore ING-IND/32 - Convertitori Macchine E Azionamenti ElettriciOceanography01 natural sciencesRunge–Kutta methodsMagnetohydrodinamic Propulsion SystemSettore ING-INF/04 - AutomaticaPhysics::Space Physics0502 economics and business0103 physical sciencesMagnetohydrodynamic driveElectromagnetic modelMagnetohydrodynamicsThermal modelbusinessInstrumentation050203 business & management
researchProduct

Photovoltaics: solar energy resources and the possibility of their use

2016

Abstract In this paper possibilities and limits of use of solar energy (like the best efficiencies of PV cells, world records and ‘notable exceptions’) were shown. Also some new ideas and concepts in photovoltaics (like new photovoltaic power plants or energy storage) were presented. Additionally authors try to predict development of solar power industry.

010302 applied physicsEnvironmental EngineeringChemistrybusiness.industryEcology (disciplines)Photovoltaic system02 engineering and technology021001 nanoscience & nanotechnologySolar energy01 natural sciencesEnergy engineeringEngineering physicsPhotovoltaic thermal hybrid solar collectorPhotovoltaics0103 physical sciencesEnvironmental ChemistryBuilding-integrated photovoltaics0210 nano-technologybusinessEcological Chemistry and Engineering S
researchProduct