Search results for "Trocar"

showing 10 items of 451 documents

Synthesis of cyanoacetic acid by electrocatalytic carboxylation of chloroacetonitrile at a silver cathode

2008

electrocarboxylation organic electrosynthesis carbon dioxide
researchProduct

Feasibility of Ultra-Short-Term Analysis of Heart Rate and Systolic Arterial Pressure Variability at Rest and during Stress via Time-Domain and Entro…

2022

Heart Rate Variability (HRV) and Blood Pressure Variability (BPV) are widely employed tools for characterizing the complex behavior of cardiovascular dynamics. Usually, HRV and BPV analyses are carried out through short-term (ST) measurements, which exploit ~five-minute-long recordings. Recent research efforts are focused on reducing the time series length, assessing whether and to what extent Ultra-Short-Term (UST) analysis is capable of extracting information about cardiovascular variability from very short recordings. In this work, we compare ST and UST measures computed on electrocardiographic R-R intervals and systolic arterial pressure time series obtained at rest and during both post…

electrocardiography (ECG)Short-Term (ST) cardiovascular variabilityBlood PressureHeart Rate Variability (HRV)Settore ING-INF/01 - ElettronicaBiochemistryAtomic and Molecular Physics and OpticsHeart Rate Variability (HRV); Short-Term (ST) cardiovascular variability; Ultra-Short-Term (UST) HRV; electrocardiography (ECG); Systolic Arterial Pressure (SAP); entropy; conditional entropy; complexity; time-series analysisUltra-Short- Term (UST) HRVAnalytical Chemistryconditional entropyElectrocardiographyHeart RateSettore ING-INF/06 - Bioingegneria Elettronica E Informaticatime-series analysisArterial PressureElectrical and Electronic EngineeringentropycomplexitySystolic Arterial Pressure (SAP)InstrumentationSensors; Volume 22; Issue 23; Pages: 9149
researchProduct

Causal and Non-Causal Frequency Domain Assessment of Spontaneous Baroreflex Sensitivity after Myocardial Infarction

2020

Acute myocardial infarction (AMI) is thought to alter the baroreflex control of arterial pressure. We tested this hypothesis investigating the changes of the cardiovascular response after AMI in comparison with young and old healthy controls studied at rest and during head-up tilt, using causal and non-causal frequency domain measures of the baroreflex sensitivity. Our results indicate: (i) the importance of using a causal approach that takes into account not only feedback but also feedforward effects in the study of interactions between the heart period and the arterial pressure; (ii) the compromised capacity of baroreceptors to control SAP fluctuations in post-AMI patients, both at rest a…

electrocardiography (ECG)medicine.medical_specialtyBaroreceptorGain measurementbusiness.industrymusculoskeletal neural and ocular physiologyPostural stresssystolic arterial pressure (SAP)Baroreflexmedicine.diseaseAcute myocardial infarction (AMI)Blood pressurebaroreflex sensitivity (BRS)Frequency domainInternal medicineSettore ING-INF/06 - Bioingegneria Elettronica E InformaticamedicineCardiologycardiovascular diseasesMyocardial infarctionSensitivity (control systems)business
researchProduct

Synergistic and Redundant Brain-Heart Information in Patients with Focal Epilepsy

2020

In this work, partial information decomposition (PID) was applied to the time series of heart rate and EEG amplitude variability to investigate the dynamical interactions in brain-heart coupling before and after epileptic seizures. From ECG and EEG signals collected on 23 children suffering from focal epilepsy, the RR intervals and the EEG variance at ipsilateral and contralateral temporal electrodes were computed in four different time windows before and after the seizures. Static PID was used to obtain redundant, unique and synergistic components of the total information shared between the series of RR and EEG variance. Results highlight, in the progression from preictal to postictal stat…

electrocardiography (ECG)partial information decompositionmedicine.medical_specialtymedicine.diagnostic_testbusiness.industryMutual informationAudiologyElectroencephalographymedicine.diseasebrain-heart interactionsEpilepsyTime windowsSettore ING-INF/06 - Bioingegneria Elettronica E InformaticaHeart rateMedicineHeart rate variabilityIn patientelectroencephalography (EEG)business2020 11th Conference of the European Study Group on Cardiovascular Oscillations (ESGCO)
researchProduct

A portable multisensor system to assess cardiorespiratory interactions through photoplethysmography

2022

Nowadays, the ever-growing interest to health and quality of life of individuals and the advancements in electronic devices technology are pushing the development of portable and wearable biomedical devices able to pursue a minimally invasive monitoring of physiological parameters in daily-life conditions. Such devices can now carry out a real-time assessment of the subjects’ overall health status and possibly even detect ongoing diseases. In this context, we have designed and implemented a multisensor portable system able to perform synchronous real-time acquisitions of electrocardiographic (ECG), photoplethysmographic (PPG) and airflow breathing signals. We investigated cardiorespiratory …

electrocardiography (ECG)photoplethysmography (PPG)Granger causality.breathing signalPortable biomedical deviceSettore ING-INF/06 - Bioingegneria Elettronica E Informaticacardiorespiratory interactionSettore ING-INF/01 - Elettronica2022 IEEE International Symposium on Medical Measurements and Applications (MeMeA)
researchProduct

Low-invasive multisensor real-time acquisition system for the assessment of cardiorespiratory and skin conductance parameters

2022

In recent years, the attention to the health and comfort of the individual, together with the electronic miniaturization progress, have led to an increased interest in the development of biomedical devices that are able to acquire a multitude of biomedical signals. Such devices should be wearable and comfortable during daily use, to be thus suitable for continuously monitoring psychophysical health states. In this context, we have designed and realized a portable biomedical device capable of real-time acquisition of electrocardiographic (ECG), photoplethysmographic (PPG), breathing and galvanic skin response (GSR) signals, for a noninvasive monitoring of multiple physiological parameters. T…

electrocardiography (ECG)photoplethysmography (PPG)Portable biomedical deviceSettore ING-INF/06 - Bioingegneria Elettronica E InformaticaInternet of Medical Things (IoMT)Settore ING-INF/01 - Elettronicagalvanic skin response (GSR)2022 IEEE 21st Mediterranean Electrotechnical Conference (MELECON)
researchProduct

Ostruzione polmonare ed aritmia respiratoria

2019

Il monitoraggio di pazienti tramite segnali fotopletismografici (PhotoPlethysmoGram, PPG) acquisiti sul polso, arteria radiale, piuttosto che sulla punta dell’indice, permette di ottenere un segnale più stabile e con maggiori informazioni, come la gittata cardiaca, la durata della contrazione ventricolare e la chiusura dell’aorta. In questo lavoro è presentata un’attività preliminare per rilevare condizioni come l’ostruzione polmonare e le apnee notturne. Si è indagato l’andamento dell’aritmia respiratoria in relazione ad eventuali difficoltà respiratorie. Per il momento ci si è limitati ad osservare soggetti sani e l’ostruzione è stata simulata facendo respirare i soggetti attraverso una c…

elettrocardiografia (ECG)Settore ING-INF/06 - Bioingegneria Elettronica E Informaticafotopletismografia (PPG)elaborazione segnaliSettore ING-INF/01 - Elettronica
researchProduct

Genetic and environmental effects on resting electrocardiography and the association between electrocardiography and physical activity, walking endur…

2010

endurancekuolleisuusympäristötekijätelectrocardiographyenvironmental effectslepophysical activityKaksostutkimustwinsmortalitykävelykaksosetwalkingagedleisureperimärestkestävyysEKGliikuntaharrastusgenomeikääntyneet
researchProduct

An unexpected ring carboxylation in the electrocarboxylation of aromatic ketones

2006

The electrocarboxylation of various aromatic ketones, carried out in N-methyl-2-pyrrolidone (NMP) in a diaphragmless cell equipped with a carbon cathode and an aluminium sacrificial anode, yielded, among the products, the target hydroxy acids, the corresponding alcohols and pinacols and, quite surprisingly, detectable amounts of substituted benzoic acids and cycloexene carboxylic acids. These compounds arise from a never reported before electrocarboxylation on the aromatic ring, respectively, for substitution of an aromatic hydrogen and from an addition reaction. For example, the electrocarboxylation of acetophenone gave rise to the substituted benzoic acids in ortho, para and meta position…

inorganic chemicalschemistry.chemical_classificationAddition reactionKetoneorganic chemicalsGeneral Chemical EngineeringReaction intermediateSettore ING-IND/27 - Chimica Industriale E TecnologicaHydrogen atom abstractionchemistry.chemical_compoundMeta-chemistryCarboxylationElectrochemistryOrganic chemistryElectrocarboxylationRing carboxylationKetonesCarbon dioxideUndivided cellsBenzoic acidAcetophenone
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct