Search results for "URC"

showing 10 items of 7748 documents

Time resolved measurements of hydrogen ion energy distributions in a pulsed 2.45 GHz microwave plasma

2017

A plasma diagnostic study of the Ion Energy Distribution Functions (IEDFs) of H+, H+2H2+, and H+3H3+ ions in a 2.45 GHz hydrogen plasma reactor called TIPS is presented. The measurements are conducted by using a Plasma Ion Mass Spectrometer with an energy sector and a quadrupole detector from HIDEN Analytical Limited in order to select an ion species and to measure its energy distribution. The reactor is operated in the pulsed mode at 100 Hz with a duty cycle of 10% (1 ms pulse width). The IEDFs of H+, H+2H2+, and H+3H3+ are obtained each 5 μs with 1 μs time resolution throughout the entire pulse. The temporal evolution of the plasma potential and ion temperature of H+ is derived from the d…

010302 applied physicsPhysicsRange (particle radiation)plasma sourcesta114plasma diagnosticsPlasmaCondensed Matter PhysicsMass spectrometry01 natural sciences7. Clean energyIon source010305 fluids & plasmasIonplasma dynamicsPhysics::Plasma Physics0103 physical sciencesThermal emittancePlasma diagnosticsionAtomic physicsMicrowaveplasma sheathsPhysics of Plasmas
researchProduct

High efficiency resonance ionization of palladium with Ti:sapphire lasers

2016

This work presents the development and testing of highly efficient excitation schemes for resonance ionization of palladium. To achieve the highest ionization efficiencies, a high-power, high repetition rate Ti:sapphire laser system was used and 2-step, 3-step and 4-step schemes were investigated and compared. Starting from different excited steps, the frequencies of the final ionization steps were tuned across the full accessible spectral range of the laser system, revealing several autoionizing Rydberg series, which converge towards the energetically higher lying state of the Pd+ ion ground state configuration. Through proper choice of these excitation steps, we developed a highly efficie…

010302 applied physicsPhysicsResonanceCondensed Matter PhysicsLaser01 natural sciencesAtomic and Molecular Physics and OpticsIon sourcelaw.inventionIonlawIonizationExcited state0103 physical sciencesPhysics::Atomic PhysicsAtomic physics010306 general physicsGround stateExcitationJournal of Physics B: Atomic, Molecular and Optical Physics
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Charge breeding at GANIL: Improvements, results, and comparison with the other facilities

2019

International audience; The 1+/n+ method, based on an ECRIS charge breeder (CB) originally developed at the LPSC laboratory, is now implemented at GANIL for the production of Radioactive Ion Beams (RIBs). Prior to its installation in the middle of the low energy beam line of the SPIRAL1 facility, the 1+/n+ system CB has been modified based on the experiments performed on the CARIBU Facility at Argone National Laboratory. Later, it has been tested at the 1+/n+ LPSC test bench to validate its operation performances. Charge breeding efficiencies as well as charge breeding times have been measured for noble gases and alkali elements. The commissioning phase started at GANIL in the second half-y…

010302 applied physicsPhysicsTest benchRange (particle radiation)mechanical instrumentstutkimuslaitteetCyclotronThermal ionization01 natural sciences7. Clean energyIon source010305 fluids & plasmaslaw.inventionNuclear physicsion sourcesUpgradeBreeder (animal)Beamlinenuclear physicslawion beam mass spectrometer0103 physical sciences[PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]ydinfysiikkaInstrumentation
researchProduct

Hydrogen plasma induced photoelectron emission from low work function cesium covered metal surfaces

2017

Experimental results of hydrogen plasma induced photoelectron emission from cesium covered metal surfaces under ion source relevant conditions are reported. The transient photoelectron current during the Cs deposition process is measured from Mo, Al, Cu, Ta, Y, Ni, and stainless steel (SAE 304) surfaces. The photoelectron emission is 2–3.5 times higher at optimal Cs layer thickness in comparison to the clean substrate material. Emission from the thick layer of Cs is found to be 60%–80% lower than the emission from clean substrates. peerReviewed

010302 applied physicsPhysicsta114HydrogenTantalumAnalytical chemistrytransitionchemistry.chemical_elementSubstrate (electronics)plasmasCondensed Matter Physics01 natural sciencesIon sourcework functions010305 fluids & plasmasion sourceschemistryAluminiumCaesium0103 physical sciencesWork functionLayer (electronics)photoemissionPhysics of Plasmas
researchProduct

Cyclotron instability in the afterglow mode of minimum-B ECRIS.

2016

It was shown recently that cyclotron instability in non-equilibrium plasma of a minimum-B electron cyclotron resonance ion source (ECRIS) causes perturbation of the extracted ion current and generation of strong bursts of bremsstrahlung emission, which limit the performance of the ion source. The present work is devoted to the dynamic regimes of plasma instability in ECRIS operated in pulsed mode. Instability develops in decaying plasma shortly after heating microwaves are switched off and manifests itself in the form of powerful pulses of electromagnetic emission associated with precipitation of high energy electrons. Time-resolved measurements of microwave emission bursts are presented. I…

010302 applied physicsPhysicsta114ta213Astrophysics::High Energy Astrophysical Phenomenaplasma instabilityCyclotronBremsstrahlungPlasma01 natural sciencesInstabilityIon sourceElectron cyclotron resonance010305 fluids & plasmaslaw.inventionTwo-stream instabilityPhysics::Plasma Physicslaw0103 physical scienceselectron cyclotron resonance ion sourcesAtomic physicsInstrumentationIon cyclotron resonanceThe Review of scientific instruments
researchProduct

Fundamentals on the Molecular Mechanism of Action of Antimicrobial Peptides

2019

Abstract Antimicrobial peptides (AMPs) are produced by several organisms as their first line of defense. Constituted by amino acids, they may present different mechanisms of action. The antimicrobial activity can be used by the peptide-producing organism itself, as innate immune strategy, or in the industry, applying as natural source preservatives. Understanding the possibilities of the operation of these compounds is a prerequisite for the development of effective uses, as well as for the establishment of combinations, which can even expand their applications considering the possibilities of genetic manipulations. Thus, the objective of this article is to review the basic principles of AM…

010302 applied physicsPhysiological functionMaterials scienceInnate immune systemComputer scienceFirst lineAntimicrobial peptides02 engineering and technology021001 nanoscience & nanotechnologyAntimicrobial01 natural sciencesAction (philosophy)0103 physical sciencesNatural sourceMolecular mechanismGeneral Materials ScienceBiochemical engineering0210 nano-technologyOrganismSSRN Electronic Journal
researchProduct

Online Management of Hybrid DRAM-NVMM Memory for HPC

2019

Non-volatile main memories (NVMMs) offer a comparable performance to DRAM, while requiring lower static power consumption and enabling higher densities. NVMM therefore can provide opportunities for improving both energy efficiency and costs of main memory. Previous hybrid main memory management approaches for HPC either do not consider the unique characteristics of NVMMs, depend on high profiling costs, or need source code modifications. In this paper, we investigate HPC applications' behaviors in the presence of NVMM as part of the main memory. By performing a comprehensive study of HPC applications and based on several key observations, we propose an online hybrid memory architecture for …

010302 applied physicsProfiling (computer programming)Source codebusiness.industryComputer sciencemedia_common.quotation_subject02 engineering and technology01 natural sciences020202 computer hardware & architectureNon-volatile memoryMemory managementEmbedded system0103 physical sciencesMemory architecture0202 electrical engineering electronic engineering information engineeringKey (cryptography)businessDrammedia_common2019 IEEE 26th International Conference on High Performance Computing, Data, and Analytics (HiPC)
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Addressing Manufacturing Challenges with Cost-Efficient Fault Tolerant Routing

2010

The high-performance computing domain is enriching with the inclusion of Networks-on-chip (NoCs) as a key component of many-core (CMPs or MPSoCs) architectures. NoCs face the communication scalability challenge while meeting tight power, area and latency constraints. Designers must address new challenges that were not present before. Defective components, the enhancement of application-level parallelism or power-aware techniques may break topology regularity, thus, efficient routing becomes a challenge.In this paper, uLBDR (Universal Logic-Based Distributed Routing) is proposed as an efficient logic-based mechanism that adapts to any irregular topology derived from 2D meshes, being an alter…

010302 applied physicsStatic routingDynamic Source Routingnetwork on chip; routing; manufacturing faultComputer sciencebusiness.industryRouting tableDistributed computingPolicy-based routing02 engineering and technology01 natural sciences020202 computer hardware & architecturenetwork on chipRouting domainLink-state routing protocolrouting0103 physical sciencesMultipath routing0202 electrical engineering electronic engineering information engineeringmanufacturing faultbusinessHierarchical routingComputer network
researchProduct