Search results for "computational physics"

showing 10 items of 725 documents

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Shallow water rogue waves in nonlinear optical fibers

2013

The dynamics of extreme waves, often known as freak or rogue waves (RW), is presently a subject of intensive research. In oceanography, RW are mostly known as a sudden deep-water event which is responsible for ship wreakages and can be modeled by the 1D Nonlinear Schrodinger Equation (NLSE). In this framework, an ideal testbed is provided by optical pulse propagation in nonlinear optical fibers: extreme solitary wave emissions during supercontinuum generation or the first experimental observation of the Peregrine solitons have indeed been carried out exploiting the modulation instability occuring in fibers with anomalous dispersion.

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Optical fiberPhysics::Optics01 natural sciences010305 fluids & plasmaslaw.inventionsymbols.namesakeZero-dispersion wavelengthlaw0103 physical sciencesDispersion (optics)14. Life underwaterRogue wave010306 general physicsNonlinear Sciences::Pattern Formation and SolitonsNonlinear Schrödinger equationComputingMilieux_MISCELLANEOUSPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]Single-mode optical fiberComputational physicsSupercontinuumClassical mechanics13. Climate actionsymbolsPeregrine soliton
researchProduct

Peregrine soliton in optical fiber-based systems

2011

International audience; We report the first observation in optics of the Peregrine soliton, a novel class of nonlinear localized structure. Two experimental configurations are explored and the impact of non-ideal initial conditions is discussed.

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Physics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]Optical fiberbusiness.industryNonlinear optics01 natural sciencesComputational physicslaw.invention010309 opticsNonlinear systemOpticsModulationlaw0103 physical sciencesPeregrine soliton010306 general physicsbusiness
researchProduct

Methane line parameters in HITRAN

2003

Abstract Two editions of the methane line parameters (line positions, intensities and broadening coefficients) available from HITRAN in 2000 and 2001 are described. In both versions, the spectral interval covered was the same (from 0.01 to 6184.5 cm −1 ), but the database increased from 48,033 transitions in 2000 to 211,465 lines in 2001 because weaker transitions of 12 CH 4 and new bands of 13 CH 4 and CH3D were included. The newer list became available in 2001 in the “Update” section of HITRAN. The sources of information are described, and the prospects for future improvements are discussed.

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Physics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]Radiation010504 meteorology & atmospheric sciences01 natural sciencesAtomic and Molecular Physics and OpticsSpectral lineMethaneComputational physicschemistry.chemical_compoundchemistry0103 physical sciencesHITRANAtomic physics010303 astronomy & astrophysicsSpectroscopy0105 earth and related environmental sciencesLine (formation)Journal of Quantitative Spectroscopy and Radiative Transfer
researchProduct

Statistical analysis of pulse propagation driven by polarization-mode dispersion

2002

International audience; The linear propagation of pulses driven by random polarization-mode dispersion is considered. Analytical expressions are derived for the probability-density functions of the pulse width, timing displacement, and degree of polarization. The study is performed in Stokes space, and frequency correlation between modes is shown to play an important role in it.

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Polarization-maintaining optical fiber02 engineering and technology01 natural sciences010309 optics020210 optoelectronics & photonicsOpticsSoliton0103 physical sciences0202 electrical engineering electronic engineering information engineeringModal dispersionOptical fibersPhysicsRandomly varying birefringence[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Polarization rotator[ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]Linear polarizationbusiness.industrySingle-mode optical fiberPolarization mode dispersionStatistical and Nonlinear PhysicsPolarization (waves)Atomic and Molecular Physics and OpticsComputational physicsPolarization mode dispersionAutocorrelationDegree of polarizationbusiness
researchProduct

Temporal coherence in mirrorless optical parametric oscillators

2012

International audience; One of the unique features of mirrorless optical parametric oscillators based on counterpropagating three-wave interactions is the narrow spectral width of the wave generated in the backward direction. In this work, we in- vestigate experimentally and numerically the influence that a strong phase modulation in the pump has on the spectral bandwidths of the parametric waves and on the efficiency of the nonlinear interaction. The effects of group-velocity mismatch and group-velocity dispersion are elucidated. In particular, it is shown that the substan- tial increase in temporal coherence of the backward-generated wave can be obtained even for pumping with a temporally…

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics][SPI.OPTI] Engineering Sciences [physics]/Optics / Photonic[PHYS.PHYS.PHYS-COMP-PH] Physics [physics]/Physics [physics]/Computational Physics [physics.comp-ph]030.1640 190.4410 190.4970 230.4320.Physics::Optics01 natural sciences[PHYS.PHYS.PHYS-COMP-PH]Physics [physics]/Physics [physics]/Computational Physics [physics.comp-ph]010309 opticsOptics[ PHYS.PHYS.PHYS-COMP-PH ] Physics [physics]/Physics [physics]/Computational Physics [physics.comp-ph]Fiber laser0103 physical sciencesSpectral width010306 general physicsParametric statisticsPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]business.industryQuantum noiseSecond-harmonic generationStatistical and Nonlinear PhysicsOptical parametric amplifierAtomic and Molecular Physics and Optics[SPI.OPTI]Engineering Sciences [physics]/Optics / Photonic[ SPI.OPTI ] Engineering Sciences [physics]/Optics / PhotonicbusinessPhase modulationCoherence (physics)Journal of the Optical Society of America B
researchProduct

H-2 vibrational spectral signatures in binary and ternary mixtures: theoretical model, simulation and application to CARS thermometry in high pressur…

2001

International audience; A summary of the main results obtained by the two groups in the field of H-2 vibrational spectral line signatures for various mixtures. in connection with CARS diagnostics of H-2-O-2 combustion systems, is presented. H-2-X Systems may have specific large inhomogeneous spectral features, due to the dependence of the line broadening and line shifting on the (H-2) radiator speed, particularly at high temperature. Thus, careful attention has to be paid to rigorously analyze such features, both from the experimental point of view (Dijon) and from the theoretical one (Besancon). Applications of the present results to high-pressure H-2/air flame thermometry are also briefly…

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]line shapeMaterials scienceSPEED-CHANGING COLLISIONSField (physics)REGIMEGeneral Physics and Astronomydiagnostic02 engineering and technologyCombustionLINE-PROFILES01 natural sciencesTemperature measurementSpectral lineOpticsDEPENDENCETEMPERATURES0103 physical sciences010306 general physicsRamanLine (formation)[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Spectral signature[ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]business.industry021001 nanoscience & nanotechnologymolecular dynamicsComputational physicsDOPPLERRadiator (engine cooling)SHAPE0210 nano-technologybusinessTernary operationcollisioncombustion
researchProduct

Radial electron fluence around ion tracks as a new physical parameter for the detection threshold of PADC using Geant4-DNA toolkit

2018

International audience; The detection threshold of poly(allyl dyglycol carbonate), PADC, for C ions is determined as 55 eV/nm in stopping power, which is significantly higher than that for proton and He ions. The stopping power is not a universal parameter for expressing the detection threshold of PADC. A new physical parameter of Radial Electron Fluence around Ion Tracks, REFIT, is proposed to describe the detection threshold of PADC. It is defined as the number density of electrons passing through the surface of a cylinder of a certain radius that is co-axial with the trajectory. Furthermore, preliminary calculations are presently being performed using the Monte Carlo simulation code of G…

[PHYS]Physics [physics]Detection thresholdRadiationMaterials scienceProtonGeant4-DNAIon trackLatent trackMonte Carlo methodREFIT02 engineering and technologyElectron021001 nanoscience & nanotechnologySecondary electronsPADC030218 nuclear medicine & medical imagingComputational physicsIon03 medical and health sciences0302 clinical medicineStopping power (particle radiation)Impact parameter0210 nano-technologyInstrumentationRadiation Measurements
researchProduct

Time-dependent screening explains the ultrafast excitonic signal rise in 2D semiconductors

2020

We calculate the time evolution of the transient reflection signal in an MoS$_2$ monolayer on a SiO$_2$/Si substrate using first-principles out-of-equilibrium real-time methods. Our simulations provide a simple and intuitive physical picture for the delayed, yet ultrafast, evolution of the signal whose rise time depends on the excess energy of the pump laser: at laser energies above the A- and B-exciton, the pump pulse excites electrons and holes far away from the K valleys in the first Brillouin zone. Electron-phonon and hole-phonon scattering lead to a gradual relaxation of the carriers towards small $\textit{Active Excitonic Regions}$ around K, enhancing the dielectric screening. The acc…

ab-initio many-body perturbation theoryMaterials scienceExciton: Physics [G04] [Physical chemical mathematical & earth Sciences]General Physics and AstronomyFOS: Physical sciences02 engineering and technology010402 general chemistry01 natural sciencesSignalCondensed Matter::Materials ScienceMonolayerGeneral Materials ScienceCondensed Matter - Materials Sciencebusiness.industryGeneral EngineeringTime evolutionMaterials Science (cond-mat.mtrl-sci)Computational Physics (physics.comp-ph)021001 nanoscience & nanotechnologytime-dependent spectroscopy0104 chemical sciencesReflection (mathematics)Semiconductor: Physique [G04] [Physique chimie mathématiques & sciences de la terre]OptoelectronicsTransient (oscillation)0210 nano-technologybusinessUltrashort pulsePhysics - Computational Physicsexciton-phonon couplingPhysics - OpticsOptics (physics.optics)
researchProduct

Dust environment of an airless object: A phase space study with kinetic models

2016

Abstract The study of dust above the lunar surface is important for both science and technology. Dust particles are electrically charged due to impact of the solar radiation and the solar wind plasma and, therefore, they affect the plasma above the lunar surface. Dust is also a health hazard for crewed missions because micron and sub-micron sized dust particles can be toxic and harmful to the human body. Dust also causes malfunctions in mechanical devices and is therefore a risk for spacecraft and instruments on the lunar surface. Properties of dust particles above the lunar surface are not fully known. However, it can be stated that their large surface area to volume ratio due to their irr…

asteroidsDusty plasma010504 meteorology & atmospheric sciencesPlasma parametersta221ta1171plasma–surface interactionPlasma-surface interactionElectronAstrophysics01 natural sciences7. Clean energyInterplanetary dust cloud0103 physical scienceskinetic particle simulationsta216Moon010303 astronomy & astrophysics0105 earth and related environmental sciencesPhysicsta115ta213ta114Astronomy and AstrophysicsPlasmaComputational physicsspace plasmaSolar windSurface-area-to-volume ratio13. Climate actionSpace and Planetary SciencePhysics::Space PhysicsAstrophysical plasmadustAstrophysics::Earth and Planetary AstrophysicsPlanetary and Space Science
researchProduct