Search results for "cost-effective"

showing 10 items of 81 documents

Early Treatment in HCV: Is it a Cost-Effective Option from the Italian Perspective?

2016

Background: The aim of this study is to perform an economic analysis to estimate the cost-utility of the early innovative therapy in Italy for managing HCV-infected patients.Methods: The incremental cost-utility analysis was carried out to quantify the benefits of the early treatment approach in HCV subjects. A Markov simulation model including direct and indirect costs and health outcomes was developed from Italian National Healthcare Service and societal perspective. 5,000 Monte Carlo simulations were performed on two distinct scenarios: Standard of Care (SoC) which includes 14.000 Genotype 1 patients in Italy treated with innovative interferon-free in the Fibrosis stage 3 and 4 (F3-F4) v…

education.field_of_studymedicine.medical_specialtyActuarial sciencebusiness.industryPopulationTime horizonIndirect costsSystematic reviewEpidemiologyHealth careMedicineeducationbusinessIncremental cost-effectiveness ratiohealth care economics and organizationsReimbursementSSRN Electronic Journal
researchProduct

Modeling cost-effectiveness and health gains of a “universal” versus “prioritized” hepatitis C virus treatment policy in a real-life cohort

2017

We evaluated the cost-effectiveness of two alternative direct-acting antiviral (DAA) treatment policies in a real-life cohort of hepatitis C virus–infected patients: policy 1, “universal,” treat all patients, regardless of fibrosis stage; policy 2, treat only “prioritized” patients, delay treatment of the remaining patients until reaching stage F3. A liver disease progression Markov model, which used a lifetime horizon and health care system perspective, was applied to the PITER cohort (representative of Italian hepatitis C virus–infected patients in care). Specifically, 8,125 patients naive to DAA treatment, without clinical, sociodemographic, or insurance restrictions, were us…

hepatitis C virusPediatricsCost effectivenessViral HepatitisAdult; Aged; Aged 80 and over; Antiviral Agents; Cohort Studies; Cost-Benefit Analysis; Health Policy; Hepatitis C; Humans; Middle Aged; Young Adult; Models Economic; HepatologyCost-Benefit AnalysisDirect-acting antiviralAdult; Aged; Aged 80 and over; Antiviral Agents; Cohort Studies; Cost-Benefit Analysis; Health Policy; Hepatitis C; Humans; Middle Aged; Young Adult; Models EconomicCohort StudiesLiver disease0302 clinical medicineModelsHealth careantiviral therapy80 and overincremental cost-effectiveness ratiohealth care economics and organizationsHCV cost -effectivenessAged 80 and overDirect-acting antiviral hepatocellular carcinoma hepatitis C virus incremental cost-effectiveness ratio interferon quality-adjusted life-years sustained virological response willingness to payCost–benefit analysis030503 health policy & servicesquality-adjusted life-yearsHealth PolicyHepatitis Chepatocellular carcinomainterferonMiddle AgedHepatitis CModels EconomicAdult; Aged; Aged 80 and over; Antiviral Agents; Cohort Studies; Cost-Benefit Analysis; Health Policy; Hepatitis C; Humans; Middle Aged; Young Adult; Models Economic; Hepatology; HCV; antiviral therapy; cost-effectiveness; real-life cohortCohortHCV030211 gastroenterology & hepatologyOriginal Articlesustained virological response0305 other medical scienceCohort studyHumanAdultmedicine.medical_specialtyEconomicAntiviral AgentsNO03 medical and health sciencesYoung Adultreal-life cohortmedicineHumansCost-Benefit Analysicost-effectivenessHealth policyAgedAntiviral AgentHepatologybusiness.industryOriginal Articlesmedicine.diseaseSurgeryCohort Studiebusinesswillingness to pay
researchProduct

Energy redevelopment of historical centres in the pursuance of the cost-effectiveness principle

2016

In historical centres the search for architectural and plant design solutions for the achievement of higher energy and environmental performances of buildings has to reconcile the preservation of the peculiarities of the building stock on the one hand and the economic efficiency of the interventions on the other one. The cost-effectiveness principle, which is adopted by European policies for the improvement of energy performances of the building stock, may be satisfied through the use of specific macro and micro-economic valuation models.

historic centreoperational model.cost-effectiveneSettore ICAR/22 - Estimoenergy redevelopment
researchProduct

First-Line Treatments for Extensive-Stage Small-Cell Lung Cancer With Immune Checkpoint Inhibitors Plus Chemotherapy: A Network Meta-Analysis and Cos…

2022

BackgroundImmune checkpoint inhibitors (ICIs) plus chemotherapy were unlikely to be considered cost-effective compared with chemotherapy as the first-line treatment of patients with extensive-stage small-cell lung cancer (ES-SCLC) in China due to its high costs. However, the cost-effectiveness of the comparison between the regimens of ICIs plus chemotherapy were remained unclear yet. The aim of this study was to evaluate the efficacy and cost-effectiveness of ICIs plus chemotherapy as the first-line treatment for ES-SCLC from the perspective of the Chinese healthcare system.MethodsA network meta-analysis (NMA) was conducted to indirect compare the clinical benefits between the ICIs plus che…

immune checkpoint inhibitorsCancer ResearchOncologyNeoplasms. Tumors. Oncology. Including cancer and carcinogenschemotherapyextensive-stage small-cell lung cancercost-effectivenessfirst-line treatmenthealth care economics and organizationsRC254-282Original ResearchFrontiers in Oncology
researchProduct

Corrigendum: Cost-Effective, Safe, and Personalized Cell Therapy for Critical Limb Ischemia in Type 2 Diabetes Mellitus.

2020

[This corrects the article DOI: 10.3389/fimmu.2019.01151.].

lcsh:Immunologic diseases. Allergycritical limb ischemiamedicine.medical_specialtyclinical trialsdiabetesbusiness.industrycost-effectivecell-based therapyImmunologyType 2 Diabetes MellitusCorrectionCritical limb ischemiamedicine.diseasecellular medicamentsCell therapyClinical trialDiabetes mellitusInternal medicinemedicineImmunology and Allergymedicine.symptombusinesslcsh:RC581-607
researchProduct

Retention forestry and biodiversity conservation: a parallel with agroforestry

2013

In forested landscapes two general management systems – retention forestry and agroforestry – have been proposed as potentially efficient components of landscape approaches to ease the conflict between biodiversity objectives and human needs. In two recent reviews, Gustafsson et al. (2012) and Lindenmayer et al. (2012) provide a global overview of current knowledge about the practice and ecological roles of retention forestry. A few years ago, Bhagwat et al. (2008) produced a similar review addressing the role of agroforestry in biodiversity conservation. Here we draw a parallel between research on the ecological effects of retention forestry and agroforestry. We argue that conservation sci…

lcsh:QH1-199.5noneForest managementBiodiversitylcsh:General. Including nature conservation geographical distributionforestBiodiversity conservationcost-effective biodiversity conservationlcsh:QH540-549.5Temperate climateNature and Landscape ConservationEcologybusiness.industryAgroforestryTaigaTropicskustannustehokkuusForestryluonnon monimuotoisuusmetsätGeographyAgricultureManagement systemta1181lcsh:EcologyluonnonsuojelubusinessNature Conservation
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Kontrollikuutio : riskipainotettu kustannusvaikuttavuuden analyysi- ja johtamismalli kunnallisessa perusterveydenhuollossa

2020

There have been calls for cost-effective public services and the integration of management control and risk management systems. Municipalities currently need to consider aging populations and diminishing financial resources. But municipal services may also include other risks, such as reputational and political risks, along with changes in legislation as well as unexpected changes in operating circumstances. Risks and how they are managed affect both the costs and the effectiveness of municipal services. However, cost-effectiveness and risks are not clear-cut concepts, especially in the public health services. Therefore, in order to better understand risks in public sector management contro…

management control systemArtikkelitterveydenhoitocost-effectivenessjulkinen sektoririsk
researchProduct

Optimization of hepatitis C virus screening strategies by birth cohort in Italy

2020

Abstract Background and Aims Cost‐effective screening strategies are needed to make hepatitis C virus (HCV) elimination a reality. We determined if birth cohort screening is cost‐effective in Italy. Methods A model was developed to quantify screening and healthcare costs associated with HCV. The model‐estimated prevalence of undiagnosed HCV was used to calculate the antibody screens needed annually, with a €25 000 cost‐effectiveness threshold. Outcomes were assessed under the status quo and a scenario that met the World Health Organization's targets for elimination of HCV. The elimination scenario was assessed under five screening strategies. Results A graduated birth cohort screening strat…

medicine.medical_specialtyCost effectivenessCost-Benefit AnalysisHepatitis C virusSettore SECS-P/06cost-effectiveneHepacivirusmedicine.disease_causeAntiviral AgentsWorld healthNO03 medical and health sciences0302 clinical medicineInternal medicinemedicineHumansMass Screeningcost-effectivenessAntibody screensHepatologyUnder-fivebusiness.industryscreeningHealth services researchhealthcost‐effectivenessHepatitis C ChronicHepatologyHepatitis CItaly030220 oncology & carcinogenesisSettore MED/42HCVOriginal Articleepidemiology030211 gastroenterology & hepatologyLiver Disease and Public HealthQuality-Adjusted Life YearsBirth cohortbusinessWHO targetscost-effectiveness HCV screening WHO targetsDemography
researchProduct

HCV eradication: a duty of the State, an option for the individual

2020

In recent years, the debate on ethical issues related to hepatitis C virus therapies has been focused on the problem of drug prices and access to therapies. Nonetheless, the goal of hepatitis C virus eradication set by the World Health Organization in 2016 is raising new ethical issues, since governments are faced with a new challenge: reaching through screening, diagnosis and treatment a large amount of subjects with undiagnosed hepatitis C infection. National governments, especially high-income countries with a Welfare State, are compelled to provide access to therapies, but also to involve those who are still unaware of their disease status. Since people cannot be forced but should be gu…

medicine.medical_specialtyCost effectivenessmedia_common.quotation_subjectHepatitis C virusmedicine.disease_causeSettore MED/02 - Storia Della Medicina03 medical and health sciences0302 clinical medicineState (polity)Settore MED/43 - Medicina Legalemedicinehcv030212 general & internal medicineEthicIntensive care medicineDutyAutonomymedia_commonEradicationEthical issuesbusiness.industryWelfare stateHepatitis Cmedicine.diseaseCost-effectivenessbusinessAutonomy
researchProduct