Search results for "cost"

showing 10 items of 5421 documents

El mite de la terra alta

2011

La identificació del camp amb la genuïnitat no és exclusiva de la cultura catalana. L’article analitza la construcció d’aquest mite en la literatura catalana del segle xix, prestant particular atenció a la derivació patriòtica que uneix paisatge, habitants i tradicions rurals amb la Catalunya real que lentament anava desapareixent com a resultat de les revolucions polítiques i industrials. El mite de la terra alta ha proporcionat símbols tan freqüentment utilitzats com ara el de la barretina (un tipus de capell) i la muntanya, així com alguns debats ben interessants sobre l’organització tradicional de la família i els contrastos entre camp-ciutat i tradició-revolució.

lcsh:Language and Literatureromanticisme; costumisme; mitologia; simbologia; literaturaUNESCO::CIENCIAS DE LAS ARTES Y LAS LETRASLingüísticaFilologíasmitologialiteraturaromanticismecostumismelcsh:Philology. Linguisticslcsh:P1-1091:CIENCIAS DE LAS ARTES Y LAS LETRAS [UNESCO]lcsh:PsimbologiaCaplletra: Revista Internacional de Filologia
researchProduct

Analytical Research Based on the Use of Low Cost Instrumentation

2019

lcsh:Pharmacy and materia medicaLow Cost InstrumentationComputer scienceAnalytical ResearchResearch basedSystems engineeringlcsh:RS1-441Pharmaceutical ScienceInstrumentation (computer programming)General Pharmacology Toxicology and PharmaceuticsGreen Analytical ChemistryPharmaceutical Sciences
researchProduct

Retention forestry and biodiversity conservation: a parallel with agroforestry

2013

In forested landscapes two general management systems – retention forestry and agroforestry – have been proposed as potentially efficient components of landscape approaches to ease the conflict between biodiversity objectives and human needs. In two recent reviews, Gustafsson et al. (2012) and Lindenmayer et al. (2012) provide a global overview of current knowledge about the practice and ecological roles of retention forestry. A few years ago, Bhagwat et al. (2008) produced a similar review addressing the role of agroforestry in biodiversity conservation. Here we draw a parallel between research on the ecological effects of retention forestry and agroforestry. We argue that conservation sci…

lcsh:QH1-199.5noneForest managementBiodiversitylcsh:General. Including nature conservation geographical distributionforestBiodiversity conservationcost-effective biodiversity conservationlcsh:QH540-549.5Temperate climateNature and Landscape ConservationEcologybusiness.industryAgroforestryTaigaTropicskustannustehokkuusForestryluonnon monimuotoisuusmetsätGeographyAgricultureManagement systemta1181lcsh:EcologyluonnonsuojelubusinessNature Conservation
researchProduct

Comparative ultrastructure and carbohydrate composition of gastroliths from Astacidae, Cambaridae and Parastacidae freshwater crayfish (Crustacea, De…

2012

21 pages; International audience; Crustaceans have to cyclically replace their rigid exoskeleton in order to grow. Most of them harden this skeleton by a calcification process. Some decapods (land crabs, lobsters and crayfish) elaborate calcium storage structures as a reservoir of calcium ions in their stomach wall, as so-called gastroliths. For a better understanding of the cyclic elaboration of these calcium deposits, we studied the ultrastructure of gastroliths from freshwater crayfish by using a combination of microscopic and physical techniques. Because sugars are also molecules putatively involved in the elaboration process of these biomineralizations, we also determined their carbohy…

lcsh:QR1-502carbohydratesAstacidea010402 general chemistry01 natural sciencesBiochemistrylcsh:MicrobiologyArticlecalcification03 medical and health scienceschemistry.chemical_compoundAstacidaeMalacostracaCrustacea14. Life underwatercalcium storage[SDV.IB.BIO]Life Sciences [q-bio]/Bioengineering/BiomaterialsMolecular Biology030304 developmental biologyorganic matrix0303 health sciencesbiologycrayfishDecapodaEcologybiology.organism_classificationCrayfish[ SDV.IB.BIO ] Life Sciences [q-bio]/Bioengineering/Biomaterialsbiomineralization6. Clean waterCambaridaeAmorphous calcium carbonate0104 chemical sciencesBiochemistrychemistryGastrolithgastrolithproteoglycans
researchProduct

THE CHALLENGE OF OPEN TIBIAL SHAFT FRACTURES: WHEN TOMANAGE WITH EXTERNAL FIXATION AND WHEN TO USEINTRAMEDULLARY NAILING?

2020

Treatment of open tibial shaft fractures is challenging. External fixation (EF) is comparatively safe in treating these open injuries with the main advantages of easy application, minimal additional disruption, and convenient subsequent soft tissue repair. Tibial intramedullary nailing (IM) is optimal for the treatment of open tibial fractures. This study aims to report the outcomes of our multi-center experience in the management of open tibial shaft fractures, evaluating the efficacy and safety of using either the external fixation (EF) or intramedullary nailing (IM).In this study, clinical-radiographic results were evaluated in 26 cases of open fractures treated with an external fixator …

lcsh:R5-920open tibial diaphyseal fracturesexternal fixationhealth costsintramedullary nailoutcomeslcsh:Medicine (General)Euromediterranean Biomedical Journal
researchProduct

Leaders – A Determinant Role

2016

Abstract No matter of the business sector the company plays in, today leadership is essential in order to be successful, because when we speak about leadership we think about the power that is the result of the connection between a leader and his followers. Today it is important to have good managers that organize and conduct the company in order to achieve the objectives, but it is more important that the managers to be good leaders that have the power to influence other in participating for achieving companies goals.

leadershipEntrepreneurshipinfluence050208 financeSocial PsychologyHF5001-6182business.industry05 social sciencesEconomics Econometrics and Finance (miscellaneous)Public relationsPower (social and political)Transformational leadershipTransactional leadershipCost leadershipOrder (business)0502 economics and businessfollowersBusiness sectorBusiness Management and Accounting (miscellaneous)050211 marketingBusinessbusinessA determinantStudies in Business and Economics
researchProduct

Influence And Leadership

2015

Abstract Because leadership is known as the process of influencing others and not only that but determining them to act in order to achieve goals, the article above emphasizes the importance of communication in this process. By understanding the essence of leadership, managers will be effective communicators and so more effectively leading their organizations through projects.

leadershipEntrepreneurshipleadership manager communication projectHF5001-6182Social Psychologycommunicationbusiness.industryEconomics Econometrics and Finance (miscellaneous)NeuroleadershipServant leadershipPublic relationsShared leadershipprojectTransformational leadershipTransactional leadershipCost leadershipBusiness Management and Accounting (miscellaneous)Leadership styleBusinessbusinessmanagerStudies in Business and Economics
researchProduct

Co-costruzione dell'apprendimento: dalla pratica riflessiva all'azione. Inquiry-Based Laboratory e action learning nella formazione dei futuri docent…

2022

Il presente lavoro espone gli esiti di una ricerca sperimentale a gruppo unico, condotta con 1350 corsisti e 120 docenti di laboratorio frequentanti il V ciclo del corso di specializzazione per le attività di sostegno didattico per le scuole dell’infanzia, primaria, secondaria di primo e secondo grado dell’Ateneo di Palermo svoltosi nell’A.A. 2020/2021. La cornice teorica all’interno della quale si delinea la ricerca è quella dell’approccio Inquiry-Based Laboratory (IBL), del Reflective Learning e dell’Action Learning, fondamentale per la costruzione di una professionalità docente competente, consapevole e responsabile. Il percorso di ricerca ha applicato il modello dell’IBL alle attività l…

learning constructionaction learningInquiry-Based Laboratoryreflective practicesupport teacher training.costruzione apprendimentoformazione docenti di sostegno.pratica riflessivaSettore M-PED/04 - Pedagogia Sperimentale
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Ancora sui limiti del criterio letterale nell'interpretazione della legge penale: le Sezioni unite "contestualizzano" l'inapplicabilità dell'aggravan…

2010

Le Sezioni unite della Cassazione confermano l'applicabilità della circostanza aggravante, prevista dall'art. 7 d.l. n. 152/1991 conv. nella l. 203/1991, ai delitti punibili in astratto con l'ergastolo, qualora in concreto venga comminata una pena diversa da quella perpetua. Nel commento alla sentenza, viene preliminarmente ricostruito il contrasto giurisprudenziale sul punto e ripercorso l'iter logico-giuridico della decisione. A partire da alcune riflessioni che la sentenza suggerisce in merito all'interpretazione della legge penale, specie in relazione ai limiti del c.d. criterio letterale, il commento considera la decisione delle Sezioni unite fondata sul rifiuto di una lettura "atomist…

legge 203/1991metodo mafiosoSettore IUS/17 - Diritto Penaleagevolazione mafiosacircostanza aggravante.art. 7 D.L. n. 152/1991
researchProduct