Search results for "dysfunction"

showing 10 items of 1129 documents

Emotional Intelligence and Psychobiosocial States: Mediating Effects of Intra-Team Communication and Role Ambiguity

2020

Emotional intelligence is an important variable related to the interaction and functioning of sports teams. The present study examined the relationship between players’ trait emotional intelligence and functional and dysfunctional psychobiosocial states. In particular, we examined the mediating effects of intra-team communication efficacy and role ambiguity in this relationship. The participants were 291 (174 men and 117 women) Italian players involved in various team sports (i.e., futsal, soccer, volleyball, handball, and rugby). They completed a multi-section questionnaire assessing the study variables during the early/middle part of their competitive seasons. Structural equation modeling…

lcsh:GE1-350vuorovaikutusbiopsykologiagroup processesälykkyyslcsh:Environmental effects of industries and plantslcsh:TJ807-830lcsh:Renewable energy sourcespsykososiaaliset tekijätdysfunctional statesemotionstunneälylcsh:TD194-195urheilutunteetjoukkueet (urheilu)emotional experiencesryhmäviestintäfunctional stateshuman activitieslcsh:Environmental sciencesurheilijatSustainability
researchProduct

Mechanisms of immunosenescence

2009

Abstract On April 7,8, 2009 a Symposium entitled "Pathophysiology of Successful and Unsuccessful Ageing" took place in Palermo, Italy. Here, the lectures of G. Pawelec, D. Dunn-Walters and. G. Colonna-Romano on T and B immunosenescence are summarized. In the elderly, many alterations of both innate and acquired immunity have been described. Alterations to the immune system in the older person are generally viewed as a deterioration of immunity, leading to the use of the catch-all term immunosenescence. Indeed, many immunological parameters are often markedly different in elderly compared to young people, and some, mostly circumstantial, evidence suggests that retained function of both innat…

lcsh:Immunologic diseases. AllergyOlder personAgingbusiness.industryGeriatrics gerontologyImmunologyShort ReportImmunosenescencelcsh:GeriatricsAcquired immune systemImmune Dysfunctionhumanitieslcsh:RC952-954.6AgeingImmune systemCMV IMMUNOSENESCENCEAGEINGImmunityImmunologyMedicinelcsh:RC581-607businessImmunity & Ageing
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Amantadine in the Treatment of Sexual Inactivity in Schizophrenia Patients Taking Atypical Antipsychotics—The Pilot Case Series Study

2021

Sexual dysfunctions in people with schizophrenia are more severe than in the general population and are an important element in the treatment of schizophrenia. The mechanism of sexual dysfunction in patients treated for schizophrenia may be related to the side effects of antipsychotic drugs (hyperprolactinemia, suppression of the reward system), but it may also be related to the pathogenesis of schizophrenia itself. The aim of the study was to present the possibility of using amantadine in the treatment of sexual dysfunction in schizophrenia without the concomitant hyperprolactinemia. In an open and naturalistic case series study, five men treated for schizophrenia in a stable mental state …

libidomedicine.medical_specialtymedicine.medical_treatmentPopulationantipsychotic drugsPharmaceutical SciencePharmacy and materia medicahyperprolactinemiaDrug Discoverymental disordersMedicineeducationAntipsychoticPsychiatryLibidoeducation.field_of_studyamantadinesex drivebusiness.industryCommunicationatypical antipsychoticsAmantadineRmedicine.diseasesexual disfunctionsRS1-441schizophreniaSexual desireSexual dysfunctionSchizophreniaMolecular MedicineMedicinemedicine.symptombusinessCase seriesmedicine.drugPharmaceuticals
researchProduct

Discounting delayed monetary rewards and decision making in behavioral addictions - A comparison between patients with gambling disorder and internet…

2019

Abstract Behavior addictions, such as Gambling Disorder and Internet Gaming Disorder, have been demonstrated to have severe negative impact. Heightened impulsivity, deficits in decision making, and cognitive biases in the preference of immediate rewards have been shown to be crucial aspects in addictive disorders. While for Gambling Disorder (GD), dysfunctional decision making has been documented before, data for Internet Gaming Disorder (IGD) are still underrepresented. In order to allow for a direct comparison of both disorders, we assessed different measures of impulsivity (trait, impulsive choice, and decision making) in a clinical sample. N = 31 patients meeting criteria for GD and n =…

media_common.quotation_subjectDecision MakingPsychological interventionMedicine (miscellaneous)Dysfunctional familyToxicologyImpulsivityBarratt Impulsiveness ScaleRewardmedicineOutpatient clinicHumansmedia_commonInternetAddictionIowa gambling taskCognitive biasBehavior AddictivePsychiatry and Mental healthClinical PsychologyGamblingImpulsive Behaviormedicine.symptomPsychologyInternet Addiction DisorderClinical psychologyAddictive behaviors
researchProduct

COX-2, Another Important Player in the Nitric Oxide–Endothelin Cross-Talk

2006

See related article, pages 1439–1445 Traditionally, the role of the endothelium was thought to be primarily that of a selective barrier to the diffusion of macromolecules from the vessel lumen to the interstitial space. During the past 20 years, numerous additional roles for the endothelium have been defined such as regulation of vascular tone, modulation of inflammation, promotion as well as inhibition of vascular growth, and modulation of platelet aggregation and coagulation. Endothelial dysfunction is a characteristic feature of patients with cardiovascular risk factors such as hypercholesterolemia, hypertension, diabetes mellitus, and chronic smoking. More recent studies indicate that i…

medicine.hormonemedicine.medical_specialtyEndotheliumPhysiologyChemistryProstacyclinInflammationmedicine.diseaseEndothelin 1EndothelinsEndocrinologymedicine.anatomical_structureInternal medicinecardiovascular systemmedicineEndothelial dysfunctionmedicine.symptomCardiology and Cardiovascular MedicineReceptorEndothelin receptormedicine.drugCirculation Research
researchProduct

0134 : Atrial fibrillation is associated with a marker of endothelial function and oxidative stress in patients with acute myocardial infarction

2016

Background Atrial fibrillation (AF), whether silent or symptomatic, is a frequent and severe complication of acute myocardial infarction (AMI). Asymmetric dimethylarginine (ADMA), an endogenous eNOS inhibitor, is a risk factor for endothelial dysfunction. We addressed the relationship between ADMA plasma levels and AF occurrence in AMI. Methods 273 patients hospitalized for AMI were included. Continuous electrocardiographic monitoring (CEM) e48 hours was recorded and ADMA was measured by High Performance Liquid Chromatography on admission blood sample. Results The incidence of silent and symptomatic AF was 39(14%) and 29 (11%), respectively. AF patients were markedly older than patients wit…

medicine.medical_specialty030204 cardiovascular system & hematology03 medical and health scienceschemistry.chemical_compound0302 clinical medicine[SDV.MHEP.CSC]Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemInternal medicineHeart ratemedicine030212 general & internal medicineMyocardial infarctionEndothelial dysfunctionRisk factorComputingMilieux_MISCELLANEOUSEjection fractionbusiness.industryIncidence (epidemiology)Atrial fibrillationEndothelial function[ SDV.MHEP.CSC ] Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemmedicine.diseaseAtrial fibrillation3. Good healthMyocardial infarctionchemistryCardiologyCardiology and Cardiovascular MedicineAsymmetric dimethylargininebusiness
researchProduct

0127: Atrial fibrillation is associated with a marker of endothelial function and oxidative stress in patients with acute myocardial infarction

2016

Background Atrial fibrillation (AF), whether silent or symptomatic, is a frequent and severe complication of acute myocardial infarction (AMI). Asymmetric dimethylarginine (ADMA), an endogenous eNOS inhibitor, is a risk factor for endothelial dysfunction. We addressed the relationship between ADMA plasma levels and AF occurrence in AMI. Methods 273 patients hospitalized for AMI were included. Continuous electrocardiographic monitoring (CEM) ≥48 hours was recorded and ADMA was measured by High Performance Liquid Chromatography on admission blood sample. Results The incidence of silent and symptomatic AF was 39(14%) and 29 (11%), respectively. AF patients were markedly older than patients wit…

medicine.medical_specialty030204 cardiovascular system & hematologyPathogenesis03 medical and health scienceschemistry.chemical_compound0302 clinical medicine[SDV.MHEP.CSC]Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemInternal medicineHeart rateMedicine030212 general & internal medicineMyocardial infarctionRisk factorEndothelial dysfunctionComputingMilieux_MISCELLANEOUSEjection fractionbusiness.industryAtrial fibrillationEndothelial function[ SDV.MHEP.CSC ] Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemmedicine.diseaseAtrial fibrillation3. Good healthMyocardial infarctionchemistryCardiologyCardiology and Cardiovascular MedicinebusinessAsymmetric dimethylarginine
researchProduct

Self-care of heart failure patients: practical management recommendations from the Heart Failure Association of the European Society of Cardiology

2020

Self-care is essential in the long-term management of chronic heart failure. Heart failure guidelines stress the importance of patient education on treatment adherence, lifestyle changes, symptom monitoring and adequate response to possible deterioration. Self-care is related to medical and person-centred outcomes in patients with heart failure such as better quality of life as well as lower mortality and readmission rates. Although guidelines give general direction for self-care advice, health care professionals working with patients with heart failure need more specific recommendations. The aim of the management recommendations in this paper is to provide practical advice for health profe…

medicine.medical_specialty2013 ACCF/AHA GUIDELINElifestyleTreatment adherenceCardiologyheart failure/dk/atira/pure/subjectarea/asjc/2700/2705Heart failureNursing030204 cardiovascular system & hematologyAMERICAN-COLLEGEEXERCISE CAPACITYpatient education03 medical and health sciencesAIR-TRAVEL0302 clinical medicineQuality of life (healthcare)MEDICATIONQUALITY-OF-LIFEHealth careself-caremedicineHumansIn patientIntensive care medicineVENTRICULAR DYSFUNCTIONbusiness.industrySymptom managementOmvårdnadSelf‐careDisease ManagementPatient educationmedicine.diseaseLifestyle3. Good healthSelf CareHeart failureChronic DiseaseSelf careQuality of LifeCARDIOVASCULAR-DISEASESSelf-care; Heart failure; Lifestyle; Patient educationPosition PaperSelf-carebusinessCardiology and Cardiovascular MedicineREDUCED EJECTION FRACTIONPatient educationTASK-FORCE
researchProduct

Treatment choices and neuropsychological symptoms of a large cohort of early MS

2018

ObjectiveTo assess clinical characteristics, distribution of disease-modifying treatments (DMTs), and neuropsychological symptoms in a large cohort of patients with early-stage MS.MethodsThe German National MS Cohort is a multicenter prospective longitudinal cohort study that has recruited DMT-naive patients with clinically isolated syndrome (CIS) and relapsing-remitting MS (RRMS) since 2010. We evaluated their baseline characteristics and the prevalence of neuropsychological symptoms.ResultsOf 1,124 patients, with a 2.2:1 female-to-male ratio and median age at onset of 31.71 years (interquartile range [IQR]: 26.06–40.33), 44.6% and 55.3% had CIS and RRMS, respectively. The median Expanded …

medicine.medical_specialty41610 Medicine & healthArticle03 medical and health sciences0302 clinical medicineQuality of lifeInterquartile rangeInternal medicinemedicineddc:610030212 general & internal medicine10. No inequalityDepression (differential diagnoses)Expanded Disability Status ScaleClinically isolated syndromebusiness.industryMultiple sclerosisNeuropsychologymedicine.disease3. Good healthNeurologyCohortNeurology (clinical)businessFunction and Dysfunction of the Nervous System030217 neurology & neurosurgery
researchProduct