Search results for "electronics"

showing 10 items of 4340 documents

Influence of the Resin Layer Thickness at the Interface of Hybrid Metal-composite Co-cured Joints

2011

As discussed in literature, the accurate analysis of the modern co-cured joints between composite materials or between a metal and a composite material (hybrid joints) is complicated by the influence of the interface resin layer on the interface singular stress field. In such joints, in fact, there is not a proper adhesive layer and the thickness of the resin layer, that plays the role of the adhesive, is not constant due to the presence of the reinforcing fibers in the composite adherent. For this reason several authors assume that a generic co-cured joint can not be studied as a simple bi-material joint, without considering the particular characteristics of the actual resin layer. This pr…

stress intensity factor.Work (thermodynamics)PhotoelasticityphotoelasticityMaterials scienceComposite numberGeneral Medicinestress intensity factorcomposite materialStress fieldSettore ING-IND/14 - Progettazione Meccanica E Costruzione Di Macchineco-cured jointAdhesiveComposite materialJoint (geology)Boundary element methodLayer (electronics)Engineering(all)Procedia Engineering
researchProduct

Tuning of Emission Wavelength of CaS:Eu by Addition of Oxygen Using Atomic Layer Deposition

2021

| openaire: EC/H2020/820423/EU//S2QUIP | openaire: EC/H2020/834742/EU//ATOP | openaire: EC/H2020/965124/EU//FEMTOCHIP Atomic layer deposition (ALD) technology has unlocked new ways of manipulating the growth of inorganic materials. The fine control at the atomic level allowed by ALD technology creates the perfect conditions for the inclusion of new cationic or anionic elements of the already-known materials. Consequently, novel material characteristics may arise with new functions for applications. This is especially relevant for inorganic luminescent materials where slight changes in the vicinity of the luminescent centers may originate new emission properties. Here, we studied the lumines…

sulfiditkalsiumTechnologyMicroscopyQC120-168.85Eu [CaS]TQH201-278.5CaS:Eu; phosphor; photoluminescence; atomic layer depositionatomikerroskasvatusharvinaiset maametallitEngineering (General). Civil engineering (General)ArticlephosphorTK1-9971Descriptive and experimental mechanicsatomic layer depositionCaS:EuphotoluminescenceElectrical engineering. Electronics. Nuclear engineeringohutkalvotTA1-2040fotoluminesenssifosforiMaterials
researchProduct

Synchronizing Two Superconducting Qubits through a Dissipating Resonator

2021

A system consisting of two qubits and a resonator is considered in the presence of different sources of noise, bringing to light the possibility of making the two qubits evolve in a synchronized way. A direct qubit–qubit interaction turns out to be a crucial ingredient, as well as the dissipation processes involving the resonator. The detrimental role of the local dephasing of the qubits is also taken into account.

superconducting devicesDephasingScienceQC1-999FOS: Physical sciencesGeneral Physics and AstronomySynchronizingAstrophysics01 natural sciencesNoise (electronics)Article010305 fluids & plasmasSynchronization (alternating current)ResonatorComputer Science::Emerging TechnologiesQuantum mechanics0103 physical sciences010306 general physicsSuperconductivityPhysicsQuantum PhysicsPhysicsQQuantum Physicsopen quantum systemsDissipationQB460-466QubitQuantum Physics (quant-ph)synchronizationEntropy
researchProduct

Time-dependent quantum transport in nanosystems : a nonequilibrium Green's function approach

2016

A time-dependent extension to the Landauer–Büttiker approach to study transient quantum transport in arbitrary junctions composed of leads and conducting devices is developed. The nonequilibrium Green’s function approach is employed for describing the charge and heat transport dynamics. The importance of the developed method is that it provides a closed formula for the time-dependent density matrix in both electronic and phononic systems. In the electronic case the nonequilibrium conditions are due to a switch-on of a bias voltage in the leads or a perturbation in the junction whereas in the phononic case the central region of interest is coupled to reservoirs of di erent temperatures. In b…

suprajohtavuusnanoelektroniikkasuperconductivitygrapheneGreen's functionsähkönjohtavuusnanorakenteetelectronic transportnanoscale electronicslämmön johtuminengrafeenikvanttifysiikkaheat transportquantum transportfononit
researchProduct

Clinical Behavior of Short Dental Implants: Systematic Review and Meta-Analysis

2020

Short implants are an increasingly common alternative to other surgical techniques in areas where bone availability is reduced. Despite the advantages they offer, a variety of biological repercussions have been described in the literature that can even lead to the loss of these. The aim of this systematic review and meta-analysis was to analyze the impact of the use of short implants on their survival and on peri-implant bone loss, evaluating the influence that length, diameter, and crown-to-implant ratio (C/I) have on these parameters. This systematic review was based on guidelines proposed by the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA). An electronic se…

survival rateWeb of scienceDentistrylcsh:MedicineReview03 medical and health sciences0302 clinical medicineQualitative analysis0502 economics and businessMedicineLead (electronics)Survival ratebusiness.industry05 social scienceslcsh:R030206 dentistryGeneral Medicineedentulous mouthShort implantsSystematic reviewMeta-analysiscrown-to-implant ratio050211 marketingImplantpartially edentulous mouthshort implantsbusinessJournal of Clinical Medicine
researchProduct

Phase retrieval of vitreous floaters: simulation experiment

2020

Knowledge of the structure of vitreous floaters is crucial to evaluate the need for surgical removal of these floaters. We simulated the phase retrieval of microstructures simulating vitreous floaters by an algorithm PhaseLift and investigate the effects of various parameters on the retrieved phase. The object under test was modulated and the coded diffraction patterns were calculated. Next, PhaseLift was used to retrieve the phase. In the current study, we simulate the effect of Gaussian and Poison noise on the phase retrieval of pure phase objects. We apply an iterative algorithm PhaseLift for phase retrieval as this algorithm requires a very few modulating masks and is able to retrieve t…

symbols.namesakeComputer scienceIterative methodGaussian noiseGaussiansymbolsPhase (waves)Shot noisePoisson distributionPhase retrievalAlgorithmNoise (electronics)Optical Design and Testing X
researchProduct

Structure and Photocatalytic Properties of TiO2-WO3Composites Prepared by Electrophoretic Deposition

2015

In this work TiO2-WO3 composite films containing different oxide concentrations were prepared by electrophoretic deposition on steel substrates. Composite coating structures were analyzed by X -ray diffraction, Raman spectra and scanning electron microscopy. The results showed an even distribution of WO3 particles in the entire composite layer. Light absorption measurements were used for photocatalytic properties evaluation. It was found that the removal ratio of methylene blue depends on the (TiO2):(WO3) concentration ratio. The most effective photodegradation was determined for the sample that was electrophoretically deposited from the suspension with the molar content ratio n(TiO2):n(WO3…

symbols.namesakeElectrophoretic depositionMaterials scienceScanning electron microscopeComposite numbersymbolsPhotocatalysisAnalytical chemistryRaman spectroscopyPhotodegradationLayer (electronics)Concentration ratioNuclear chemistryIOP Conference Series: Materials Science and Engineering
researchProduct

Vibrational properties of semiconductor nanowires and nanowire heterostructures: ensembles and single nanowires

2013

symbols.namesakeMaterials scienceSemiconductorbusiness.industryNanowiresymbolsOptoelectronicsGeneral Materials ScienceHeterojunctionCondensed Matter PhysicsbusinessRaman scatteringphysica status solidi (RRL) - Rapid Research Letters
researchProduct

<title>Electrochromism of W-oxide-based films: some theoretical and experimental results</title>

1995

We survey some recent work related to electrochromic W-oxide-based thin films. The electronic structure of cubic (perovskite) WO3 and HWO3 was calculated from first principles. It was found, among other things, that hydroxide formation was energetically favored. Experimental studies were made on films prepared by reactive magnetron sputtering in Ar + O2 with and without CF4 addition and substrate bias. Structural studies by atomic force microscopy, x-ray diffraction, infrared reflectance spectroscopy, and Raman spectroscopy indicated that the electron bombardment associated with a positive substrate bias led to grain growth and partial crystallization while maintaining a high density of W e…

symbols.namesakeMaterials scienceSputteringScanning electron microscopeElectrochromismAnalytical chemistrysymbolsSubstrate (electronics)Thin filmSputter depositionRaman spectroscopyPerovskite (structure)SPIE Proceedings
researchProduct

Effect of Fe-incorporation on Structural and Optoelectronic Properties of Spin Coated p/n Type ZnO Thin Films

2020

symbols.namesakeRadiationMaterials sciencebusiness.industrysymbolsOptoelectronicsGeneral Materials ScienceThin filmCondensed Matter PhysicsbusinessSpin (physics)Raman scatteringJournal of Nano- and Electronic Physics
researchProduct