Search results for "elete"

showing 10 items of 37 documents

EFFECT OF DELETERIOUS MUTATION-ACCUMULATION ON THE FITNESS OF RNA BACTERIOPHAGE MS2

2000

RNA viruses show the highest mutation rate in nature. It has been extensively demonstrated that, in the absence of purifying selection, RNA viruses accumulate deleterious mutations at a high rate. However, the parameters describing this accumulation are, in general, poorly understood. The present study reports evidences for fitness declines by the accumulation of deleterious mutations in the bacteriophage MS2. We estimated the rate of fitness decline to be as high as 16% per bottleneck transfer. In addition, our results agree with an additive model of fitness effects.

GeneticsExperimental evolutionMutation rateBase SequenceGenotypeRNABiologybiology.organism_classificationNegative selectionMutationBacteriophage MS2GeneticsFitness effectsGeneral Agricultural and Biological SciencesDeleterious mutationEcology Evolution Behavior and SystematicsDNA PrimersLevivirusEvolution
researchProduct

Teleasentajien viime vuosikymmenet : haastattelututkimus teleasentajien kokemuksista työnsä muuttumisesta 1970-2010-lukujen aikana

2016

Tutkimukseni käsittelee teleasentajien työn muutosta ja heidän kokemuksiaan siitä noin vuosiluvuilta 1970-2010. Telealan kehitys on ollut nopeatempoista, joten miten alalla pitkän työuran tehneet henkilöt ovat pysyneet mukana? Kuinka heidän työnsä ja työelämänsä ovat muuttuneet aikajakson aikana, mitä he ovat kokeneet muutosten aikana, ja miten he suhtautuvat näihin muutoksiin? Millä tavalla teleasentajan työ 2010-luvulla eroaa 1970-luvun työstä? Tutkielma on jatkoa tekijän kandidaatintutkielmalle. Tutkimus on toteutettu haastattelemalla seitsemää 45-85-vuotiasta miestä, jotka ovat työskennelleet telealalla yli 30 vuoden ajan. Heistä suurin osa on aloittanut työuransa 1970-luvulla. Haastate…

Haastattelututkimusmuistitietotietoliikenneasentajattyöorganisaatiomuutokset1990-lukuteleasentajateletekninen asiantuntijaorganisaatiomuutosmuistitietotutkimustietoliikenneasentajatyöelämätelealaliikelaitosuudistus
researchProduct

Engagement as a Driver of Growth of Online Health Forums: Observational Study

2017

Background: The emerging research on nurturing the growth of online communities posits that it is in part attributed to network effects, wherein every increase in the volume of user-generated content increases the value of the community in the eyes of its potential new members. The recently introduced metric engagement capacity offers a means of quantitatively assessing the ability of online platform users to engage each other into generating content; meanwhile, the quantity engagement value is useful for quantifying communication-based platform use. If the claim that higher engagement leads to accelerated growth holds true for online health forums (OHFs), then engagement tracking should be…

Male020205 medical informaticssocial network analysisverkkoyhteisötkeskustelupalstatHealth Informatics02 engineering and technologyonline health forumengagement capacityverkostoanalyysiGranger causality020204 information systems0202 electrical engineering electronic engineering information engineeringeHealthHumansteleterveydenhuoltoSocial network analysista113Original PaperInternetbusiness.industryCommunicationSocial Supportsitoutuminenonline health communityHealth ServicesCausalityTelemedicinesuperuserThe InternetObservational studyeHealthFemaleMetric (unit)businessPsychologyValue (mathematics)Social psychologyengagementJournal of Medical Internet Research
researchProduct

Patients' experiences of the complex trust-building process within digital cardiac rehabilitation.

2021

The development of digital solutions is becoming increasingly important in facing global challenges. Therefore, research on this topic is important in taking into account cardiac patients’ experiences of the rehabilitation process for the design of digital counseling solutions. The aim of the present qualitative study was to explore the different meanings that patients give to the rehabilitation process using a Glaserian grounded theory (GT) approach. Qualitative interviews were conducted with 30 participants from a rehabilitation center in Finland. The findings indicated a “complex trust-building process” core category comprising five categories of trust-building in rehabilitation: feeling…

MalekognitioComputer and Information SciencesCardiovascular ProceduresScienceEmotionsSocial SciencesSurgical and Invasive Medical ProceduresTrustRehabilitation MedicineComputer SoftwareCognitiontunteetAdaptation PsychologicalMedicine and Health SciencesPsychologyHumansPublic and Occupational HealthsydäntauditteleterveydenhuoltoFinlandQualitative ResearchBehaviorCardiac RehabilitationCoronary Artery Bypass GraftingQRBiology and Life SciencesSoftware EngineeringHeartPhysical ActivityMiddle AgedluottamusterveyskäyttäytyminenGrounded TheoryCardiovascular AnatomyCognitive ScienceEngineering and TechnologyMedicineFemalekuntoutusAnatomyfyysinen aktiivisuusohitusleikkauksetResearch ArticleNeurosciencePLoS ONE
researchProduct

Reducing health inequalities trough digital options in mental health: A physician's perspective.

2019

This paper explores the physicians’ perspective regarding the potential of computerised Cognitive Behavioural Therapies (cCBTs) to overcome inequalities in the context of mental health care provision. The main benefits were related to the ability of cCBTs to provide care in a convenient and efficient manner, enhancing its accessibility. These aspects were perceived more important than cost-effectivity of treatment, which is often claimed to be the key benefit of cCBTs. Age and general acceptance of CBT were the most significant individual-level separators of perceptions, while the sector in which the physician works was seen as the main structural-level separator. peerReviewed

Maleterveyspalvelutphysiciansmedicine.medical_treatmentHealth Services AccessibilitymielenterveysSurveys and Questionnaireshealth care provisionteleterveydenhuoltolääkäritta512Finlandmedia_commonta316Marketing05 social sciencesCognitionMiddle AgedHealth equity3. Good healthCognitive behavioral therapyGeneral Health ProfessionseriarvoisuusMental health carekognitiivinen käyttäytymisterapiaFemalehealth inequality0305 other medical sciencePsychologyAdultMental Health ServicesInequalityAttitude of Health Personnelmedia_common.quotation_subject03 medical and health sciencesNursingPerceptionPhysicians0502 economics and businessmedicinekäsityksetHumanscCBThealth servicesAged030505 public healthCognitive Behavioral TherapyHealth Status DisparitiesMental healthHealth care deliveryTherapy Computer-Assisted050211 marketingmielenterveyspalvelutHealth marketing quarterly
researchProduct

Genomic determinants of protein folding thermodynamics in prokaryotic organisms.

2004

Here we investigate how thermodynamic properties of orthologous proteins are influenced by the genomic environment in which they evolve. We performed a comparative computational study of 21 protein families in 73 prokaryotic species and obtained the following main results. (i) Protein stability with respect to the unfolded state and with respect to misfolding are anticorrelated. There appears to be a trade-off between these two properties, which cannot be optimized simultaneously. (ii) Folding thermodynamic parameters are strongly correlated with two genomic features, genome size and G+C composition. In particular, the normalized energy gap, an indicator of folding efficiency in statistical…

Models MolecularProtein DenaturationProtein FoldingProtein familyArchaeal ProteinsThermodynamicsdeleterious mutationsthermophilic proteinsBiologymonte-carlo algorithmGenomeNegative selectionBacterial ProteinsStructural BiologyMolecular evolutionGenome ArchaealevolutionbuchneraMolecular BiologyGenome sizeGeneticsPrincipal Component Analysisacid side-chainsBacteriaSequence Homology Amino Acidreplica approachComputational BiologystabilityGenetic codeArchaeaPRI BioscienceFolding (chemistry)endosymbiotic bacteriacation-pi interactionsThermodynamicsProtein foldingHydrophobic and Hydrophilic InteractionsGenome BacterialJournal of molecular biology
researchProduct

Theory-based digital intervention to promote weight loss and weight loss maintenance (Choosing Health)

2020

IntroductionDigital behavioural weight loss interventions have the potential to improve public health; however, these interventions are often not adequately tailored to the needs of the participants. This is the protocol for a trial that aims to determine the effectiveness and cost-effectiveness of the Choosing Health programme as a means to promote weight loss and weight loss maintenance among overweight/obese adults.Methods and analysisThe proposed study is a two-group randomised controlled trial with a nested interrupted time series (ITS) within-person design. Participants (n=285) will be randomly assigned to either the Choosing Health digital intervention or a control group. For interve…

N of 1 trialComparative Effectiveness ResearchPsychological interventionOverweightCardiovascularOral and gastrointestinalDISEASElaw.inventionBEHAVIORAL INTERVENTIONSRandomized controlled trialWeight losslaw1506teleterveydenhuoltoRandomized Controlled Trials as TopicNutrition and MetabolismElectronic Mailpublic healthRPRIMARY-CAREGeneral MedicineinterventiotutkimusStrokeN-OF-1OBESITYPublic Health and Health ServicesMedicinemedicine.symptom1714Adultmedicine.medical_specialtyClinical Trials and Supportive ActivitiesClinical Sciencespreventive medicinepainonhallintaDIETQuality of life (healthcare)Clinical ResearchWeight LossmedicineHumansObesityMetabolic and endocrinePreventive healthcareNutritionnutrition & dieteticsOther Medical and Health SciencesOVERWEIGHTbusiness.industryPublic healthPreventionlaihdutusADULTSOverweightPHYSICAL-ACTIVITYCost Effectiveness ResearchterveyskäyttäytyminenPhysical therapyQuality of Life3.1 Primary prevention interventions to modify behaviours or promote wellbeingPolandGeneric health relevancebusinessBMJ Open
researchProduct

Effectiveness of Distance Technology in Promoting Physical Activity in Cardiovascular Disease Rehabilitation : Cluster Randomized Controlled Trial, A…

2021

BackgroundPhysical activity is beneficial for cardiovascular rehabilitation. Digitalization suggests using technology in the promotion of physical activity and lifestyle changes. The effectiveness of distance technology interventions has previously been found to be similar to that of conventional treatment, but the added value of the technology has not been frequently studied. ObjectiveThe aim of this pilot study was to investigate whether additional distance technology intervention is more effective in promoting physical activity than non-technology–based treatment in 12 months of cardiac rehabilitation. MethodsThe cardiovascular disease rehabilitation intervention consisted of three 5-day…

Original Paperexerciseclinical trialetäpalvelutsatunnaistetut vertailukokeetrehabilitationcardiovascular diseasescardiac rehabilitationtechnologyrandomized controlled trialMedical technologysydän- ja verisuonitauditkliiniset kokeetkuntoutusR855-855.5teleterveydenhuoltolääkinnällinen kuntoutusfyysinen aktiivisuusliikuntahoito
researchProduct

A Smartphone App to Promote Healthy Weight Gain, Diet, and Physical Activity During Pregnancy (HealthyMoms): Protocol for a Randomized Controlled Tri…

2019

BACKGROUND: Excessive gestational weight gain is common and associated with adverse outcomes both in the short and long term. Although traditional lifestyle-based interventions have shown to mitigate excess gestational weight gain, little is known about whether mobile Health (mHealth) apps can promote healthy weight gain, diet, and physical activity during pregnancy. OBJECTIVE: The primary aim of the HealthyMoms trial is to determine the effectiveness of a smartphone app (HealthyMoms) for mitigating excess gestational weight gain during pregnancy. Secondary aims are to determine the effectiveness of the app on dietary habits, physical activity, body fatness, and glycemia during pregnancy. M…

Original Papermobile phoneNutrition and DieteticsexercisekuntoliikuntaraskaussmartphonepainonhallintatelelääketiedeNäringsläragestational weight gainmobiilisovelluksettelemedicinepregnancyteleterveydenhuoltodietJMIR Research Protocols
researchProduct

Next-Generation Sequencing-Based RiboMethSeq  Protocol for Analysis of tRNA 2'-O-Methylation.

2016

Analysis of RNA modifications by traditional physico-chemical approaches is labor  intensive,  requires  substantial  amounts  of  input  material  and  only  allows  site-by-site  measurements.  The  recent  development  of  qualitative  and  quantitative  approaches  based  on   next-generation sequencing (NGS) opens new perspectives for the analysis of various cellular RNA  species.  The  Illumina  sequencing-based  RiboMethSeq  protocol  was  initially  developed  and  successfully applied for mapping of ribosomal RNA (rRNA) 2'-O-methylations. This method also  gives excellent results in the quantitative analysis of rRNA modifications in different species and  under varying growth condi…

Sequence Analysis RNAComputational BiologyHigh-Throughput Nucleotide Sequencing2′-O-methylationhigh-throughput sequencingRNA FungalSaccharomyces cerevisiaeMethylationArticledeleted strainRNA BacterialRNA TransferTRM3Escherichia coliTrmHtRNARiboMethSeqBiomolecules
researchProduct