Search results for "eps"

showing 10 items of 1777 documents

Pancreatic Fistulae after Urologic Surgery - A Single Centre Experience.

2015

<b><i>Introduction:</i></b> To evaluate incidence, symptoms and management of postoperative pancreatic fistula (POPF) after urologic surgery based on our experience. <b><i>Material and Methods:</i></b> Database was searched for clinically evident POPF after urologic surgery between 1998 and 2014. Fistulae were graded using the POPF classification. Clinical course of every POPF patient was evaluated. <b><i>Results:</i></b> During this time, 3,200 surgeries for renal, adrenal and retroperitoneal pathologies were performed. Twelve POPF occurred postoperatively in this series. Eight fistulae were POPF grade A, 3 POPF grade …

AdultMalemedicine.medical_specialtyUrologyMalignancySepsisPancreatic FistulaYoung AdultmedicineUrologic surgeryHumansAgedRetrospective StudiesAged 80 and overbusiness.industryIncidence (epidemiology)IncidenceMiddle Agedmedicine.diseaseSurgerySingle centrePancreatic fistulaUrologic Surgical ProceduresFemalePositive Surgical MarginbusinessComplicationUrologia internationalis
researchProduct

Blood Flow Restriction Alters Motor Unit Behavior During Resistance Exercise.

2019

AbstractWe aimed to determine whether blood flow restriction (BFR) alters the characteristics of individual motor units during low-intensity (LI) exercise. Eight men (26.0±3.8 yrs) performed 5 sets of 15 knee extensions at 20% of one-repetition maximum (with and without BFR). Maximal isometric voluntary contractions (MVC) were performed before and after exercise to quantify force decrement. Submaximal isometric voluntary contractions were additionally performed for 18 s, matching trapezoidal target-force trajectories at 40% pre-MVC. EMG activity was recorded from the vastus lateralis muscle. Then, signals were decomposed to extract motor unit recruitment threshold, firing rates and action p…

AdultMalemedicine.medical_specialtyVastus lateralis muscleAction PotentialsPhysical Therapy Sports Therapy and RehabilitationIsometric exercise030204 cardiovascular system & hematologyBlood flow restrictionQuadriceps Muscle03 medical and health sciencesYoung Adult0302 clinical medicinePhysical medicine and rehabilitationIsometric ContractionmedicineHumansOrthopedics and Sports MedicineKaatsubusiness.industryResistance trainingResistance Training030229 sport sciencesConstrictionMotor unitRegional Blood FlowMotor unit recruitmentMuscle strengthbusinessInternational journal of sports medicine
researchProduct

The effect of swinging the arms on muscle activation and production of leg force during ski skating at different skiing speeds

2016

The study investigated the effects of arm swing during leg push-off in V2-alternate/G4 skating on neuromuscular activation and force production by the leg muscles. Nine skilled cross-country skiers performed V2-alternate skating without poles at moderate, high, and maximal speeds, both with free (SWING) and restricted arm swing (NOSWING). Maximal speed was 5% greater in SWING (P<0.01), while neuromuscular activation and produced forces did not differ between techniques. At both moderate and high speed the maximal (2% and 5%, respectively) and average (both 5%) vertical force and associated impulse (10% and 14%) were greater with SWING (all P<0.05). At high speed range of motion and angular …

AdultMalemedicine.medical_specialtyVastus medialisBiophysicsarm swingExperimental and Cognitive PsychologyKnee extensionBicepsLeg muscle03 medical and health sciencesYoung Adult0302 clinical medicinePhysical medicine and rehabilitationEMGSkiingmedicineHumansOrthopedics and Sports MedicineRange of Motion ArticularMuscle Skeletalta315MathematicsLegMuscle activation030229 sport sciencesGeneral MedicineSwingBiomechanical Phenomenabody regionsArm swingAthletesski forcesPhysical therapyArmRange of motionhuman activitiescross-country skiing030217 neurology & neurosurgeryHuman Movement Science
researchProduct

Neuromuscular fatigue following high versus low-intensity eccentric exercise of biceps brachii muscle

2009

International audience; Purpose: This study investigated neuromuscular fatigue following high versus low-intensity eccentric exercise corresponding to the same amount of work.Methods: Ten volunteers performed two eccentric exercises of the elbow flexors: a high-intensity versus a low-intensity exercise. Maximal voluntary contraction torque and surface electromyography of the biceps brachii muscle were recorded before, immediately and 48 h after exercises. Maximal voluntary activation level, neural (M-wave) and contractile (muscular twitch) properties of the biceps brachii muscle were analysed using electrical stimulation techniques.Results: Maximal voluntary contraction torque was significa…

AdultMalemedicine.medical_specialtyVoluntary activationMovementElbowPhysical ExertionBiophysicsNeuroscience (miscellaneous)Neuromuscular Junction[SHS.SPORT.PS]Humanities and Social Sciences/Sport/Sport physiologyElectromyographyBiceps[ SHS.SPORT ] Humanities and Social Sciences/Sport03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationElbow JointMedicineEccentricHumansMuscle Skeletal[SHS.SPORT]Humanities and Social Sciences/SportMuscular twitchmedicine.diagnostic_testBiceps brachii musclebusiness.industryWork (physics)[ SHS.SPORT.PS ] Humanities and Social Sciences/Sport/Sport physiology030229 sport sciencesBiceps brachiiM-waveIntensity (physics)medicine.anatomical_structureEccentric exerciseMVCMuscle FatiguePhysical EnduranceFemaleNeurology (clinical)business030217 neurology & neurosurgeryMuscle Contraction
researchProduct

Effects of different accentuated eccentric load levels in eccentric-concentric actions on acute neuromuscular, maximal force, and power responses.

2009

This study examined the effects of different dynamic accentuated external resistance load levels during the eccentric(ECC) phase of ECC-concentric (CON) actions on acute neuromuscular, maximal force, and power responses in the bench press exercise in male subjects (age, = 32 +/- 4 years; n = 11). Four maximum strength sessions consisted of 1 repetition maximum (RM) lifts with traditional isoinertial resistances and of 1RM lifts with the different dynamic accentuated external resistance (DAER) loads of 100, 105, 110, and 120% of 1 RM for the ECC phase, whereas 100% of 1RM was constantly used for the CON phase. One explosive strength session consisted of explosive repetitions with the 50, 60,…

AdultMalemedicine.medical_specialtyWeight LiftingDeltoid curveRepetition maximumPhysical Therapy Sports Therapy and RehabilitationElectromyographyConcentricBench pressBicepsInternal medicineIsometric ContractionmedicineEccentricHumansOrthopedics and Sports MedicineMuscle StrengthMuscle SkeletalAnalysis of Variancemedicine.diagnostic_testAnthropometrybusiness.industryElectromyographyGeneral MedicineAdaptation PhysiologicalPower (physics)CardiologybusinessMuscle ContractionJournal of strength and conditioning research
researchProduct

The effects of whey protein with or without carbohydrates on resistance training adaptations.

2015

Background Nutrition intake in the context of a resistance training (RT) bout may affect body composition and muscle strength. However, the individual and combined effects of whey protein and carbohydrates on long-term resistance training adaptations are poorly understood. Methods A four-week preparatory RT period was conducted in previously untrained males to standardize the training background of the subjects. Thereafter, the subjects were randomized into three groups: 30 g of whey proteins (n = 22), isocaloric carbohydrates (maltodextrin, n = 21), or protein + carbohydrates (n = 25). Within these groups, the subjects were further randomized into two whole-body 12-week RT regimens aiming …

AdultMalemedicine.medical_specialtyWhey proteinCarbohydratesBlood lipidsSkeletal muscleContext (language use)Isometric exerciseBiologyMuscle hypertrophyAbsorptiometry PhotonDouble-Blind MethodInternal medicinemedicineDietary CarbohydratesHumansMuscle StrengthLeg pressMuscle SkeletalNutritionNutrition and DieteticsResearchSkeletal muscleResistance TrainingHypertrophyAdaptation PhysiologicalLipidsQuadriceps femoris muscleSports Nutritional Physiological Phenomenamedicine.anatomical_structureEndocrinologyWhey ProteinsDietary SupplementsBody CompositionFood ScienceSupplementJournal of the International Society of Sports Nutrition
researchProduct

Sex differences in allelic frequencies of the 5-HT2C Cys23Ser polymorphism in psychiatric patients and healthy volunteers: findings from an associati…

2000

Polymorphisms in the serotonergic system are believed to play a role in the etiology and treatment of different psychiatric illnesses. The 5-HT2C receptor gene is X-linked, with a frequent mutation at nucleotide 68 leading to a Ser-->Cys transition at amino acid 23. Recent studies have demonstrated an impaired function of 5-HT2C receptors and an increased production of the major noradrenergic metabolite 3-methoxy-4-hydroxyphenylethyleneglycol in the cerebrospinal fluid among the subjects carrying the Ser23 allele (Lappalainen et al., 1999). Biol. Psychiatry 46:821). We genotyped patients with alcohol dependence, panic disorder without agoraphobia, generalized anxiety disorder, narcolepsy an…

AdultMalemedicine.medical_specialtyX ChromosomeGeneralized anxiety disorderGene FrequencyReference ValuesGenotypeReceptor Serotonin 5-HT2CSerineGeneticsmedicineHumansCysteineAllelePsychiatryAllele frequencyAllelesBiological PsychiatryGenetics (clinical)NarcolepsySex CharacteristicsPolymorphism Geneticbusiness.industryMental DisordersPanic disorderAlcohol dependenceMiddle Agedmedicine.diseaseAnxiety DisordersAlcoholismPsychiatry and Mental healthAmino Acid SubstitutionReceptors SerotoninPanic DisorderFemalebusinessAgoraphobiaNarcolepsyPsychiatric Genetics
researchProduct

Individual Region- and Muscle-specific Hamstring Activity at Different Running Speeds

2019

Introduction \ud Hamstring strain injuries typically occur in the proximal biceps femoris long head (BFlh) at high running speeds. Strain magnitude seems to be the primary determinant of strain injury, and may be regulated by muscle activation. In running, BFlh strain is largest in the proximal region, especially at high speeds. However, region-specific activity has not been examined. This study examined the proximal–distal and intermuscular activity of BFlh and semitendinosus (ST) as a function of increasing running speed.\ud \ud Methods \ud Thirteen participants ran at steady speeds of 4.1 (slow), 5.4 (moderate), and 6.8 m·s−1 (fast) on a treadmill. Region- and muscle-specific EMG activit…

AdultMalemedicine.medical_specialtybiceps femorisrasitusvammatQP301.H75_Physiology._Sport.Hamstring MusclesPhysical Therapy Sports Therapy and RehabilitationStrain (injury)ElectromyographyIsometric exerciseBiologyBicepsRunningjuoksuTendonsYoung Adult03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationstrain injuriesIsometric ContractionliikuntakykymedicineHumansOrthopedics and Sports MedicineTreadmillHamstring injurymedicine.diagnostic_testGV557_SportsElectromyographyproximal-distal differencesinjury mechanism030229 sport sciencesSwingmedicine.diseaseBiomechanical Phenomenamuscle mechanicslocomotionelektromyografiaSprains and StrainssemitendinosusbiomekaniikkaHamstring
researchProduct

High-density electromyography activity in various hamstring exercises

2019

Proximal-distal differences in muscle activity are rarely considered when defining the activity level of hamstring muscles. The aim of this study was to determine the inter-muscular and proximal-distal electromyography (EMG) activity patterns of hamstring muscles during common hamstring exercises. Nineteen amateur athletes without a history of hamstring injury performed 9 exercises, while EMG activity was recorded along the biceps femoris long head (BFlh) and semitendinosus (ST) muscles using 15-channel high-density electromyography (HD-EMG) electrodes. EMG activity levels normalized to those of a maximal voluntary isometric contraction (%MVIC) were determined for the eccentric and concentr…

AdultMalemedicine.medical_specialtyharjoitteetinjury reductionHamstring MusclesPhysical Therapy Sports Therapy and RehabilitationIsometric exerciseElectromyography030204 cardiovascular system & hematologyConcentricBicepsrehabilitationRC1200Young Adult03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationIsometric ContractionHumansMedicineEccentricKneeOrthopedics and Sports Medicineheterogeneous activityRange of Motion ArticularLeg curlta315ExerciseHamstring injuryurheiluvammatHipmedicine.diagnostic_testGV557_SportslihasaktiivisuusElectromyographybusiness.industryreidet030229 sport sciencesmedicine.diseaseHamstring exerciseselektromyografiaTorqueAthleteskuntoutusbusinessScandinavian Journal of Medicine and Science in Sports
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct