Search results for "events"

showing 10 items of 514 documents

Temporal evolution of stress in the year prior to the onset of depressive disorders

1999

Abstract Background . We investigate how the stress levels in a sample of patients with depressive disorders vary in the year prior to the onset of symptoms. Design . Observational study of the case/control type. Fifty patients whose first depressive episode began in the 6 months prior to the interview Method . The LEDS was applied to all the subjects. A calculation was made of the evolution week by week of stress throughout the year prior to the onset. Results . Notable differences were detected in the temporal profile of the stress between the depressive patients and control groups. The differences between them were especially far-reaching in the 26 weeks prior to the onset of the symptom…

AdultMalemedicine.medical_specialtyPediatricsTime FactorsObservationmedicine.disease_causeSeverity of Illness IndexExtinction PsychologicalStress levelLife Change EventsSeverity of illnessStress (linguistics)medicineHumansPsychological stressPsychiatryDepression (differential diagnoses)Depressive DisorderDisease progressionCase-control studyPsychiatry and Mental healthClinical PsychologyCase-Control StudiesDisease ProgressionFemaleObservational studyPsychologyStress PsychologicalJournal of Affective Disorders
researchProduct

Predictors of complicated grief in mourners of sudden cardiac death.

2021

AdultMalemedicine.medical_specialtyPsychological TraumaSudden cardiac deathLife Change EventsRisk FactorsmedicineHumansIntensive care medicineAgedPsychological Testsbusiness.industryGeneral MedicineMiddle Agedmedicine.diseaseObject AttachmentComplicated griefProlonged Grief DisorderCross-Sectional StudiesDeath Sudden CardiacEmergency MedicineFemaleGriefbusinessStress PsychologicalThe American journal of emergency medicine
researchProduct

Neuroticism, extraversion, stressful life events and asthma: a cohort study of middle-aged adults

2009

ABSTRACT Background: Stressful life events can trigger asthma exacerbations, but could also contribute to the development of incident asthma. However, only few studies have investigated the association between stressful life events and adult asthma prospectively. Likewise, stress-related personality traits (e.g. neuroticism and extraversion) may increase asthma risk, but this has been examined in only one prospective study. We therefore aimed to investigate the association between neuroticism, extraversion, stressful life events and incident asthma. Methods: A population-based sample of 5114 middle-aged adults completed questionnaires between 1992 and 1995. Among those alive in 2002/2003, 4…

AdultMalemedicine.medical_specialtyRMNeurotic DisordersPersonality InventoryImmunologyPopulationCohort StudiesExtraversion PsychologicalLife Change Eventssymbols.namesakeRisk FactorsSurveys and QuestionnairesmedicineHumansImmunology and AllergyPoisson regressionBig Five personality traitseducationAgedAsthmaeducation.field_of_studyExtraversion and introversionbusiness.industryMiddle Agedmedicine.diseaseNeuroticismR1AsthmaSurgeryRelative risksymbolsFemalebusinessStress PsychologicalDemographyCohort study
researchProduct

An adaptive display for the treatment of diverse trauma PTSD victims.

2009

El trastorno de estrés postraumático (TEPT) puede desarrollarse después de la exposición a un evento aterrador. Las personas que sufren de trastorno de estrés postraumático presentan hiperactividad y evitación, y experimentan síntomas que provocan angustia y deterioro en áreas de vida significativas. Los programas de comportamiento cognitivo, incluida la terapia de exposición, son actualmente el tratamiento de elección para el TEPT. Aunque estos programas son eficaces, hay margen de mejora; La utilización de la terapia de exposición por los médicos es baja y las tasas de desgaste son altas. La aplicación de nuevas tecnologías, especialmente la realidad virtual (VR), podría ayudar a superar …

AdultMalemedicine.medical_specialtySocial PsychologyAdolescentmedicine.medical_treatmentExposure therapyPilot ProjectsVirtual realityStatistics NonparametricFight-or-flight responseLife Change EventsStress Disorders Post-TraumaticUser-Computer Interfacemental disordersmedicineHumansComputer SimulationPsychiatryApplied PsychologyAgedCommunicationPatient SelectionFlexibility (personality)CognitionGeneral MedicineMiddle AgedComputer Science ApplicationsHuman-Computer InteractionPosttraumatic stressDistressTreatment OutcomePsicologiaFemalePersonalitatPsychologyClinical psychologyCyberpsychology, behavior and social networking
researchProduct

Cingulo-Insular Structural Alterations Associated with Psychogenic Symptoms, Childhood Abuse and PTSD in Functional Neurological Disorders

2017

Objective Adverse early-life events are predisposing factors for functional neurological disorder (FND) and post-traumatic stress disorder (PTSD). Cingulo-insular regions are implicated in the biology of both conditions and are sites of stress-mediated neuroplasticity. We hypothesised that functional neurological symptoms and the magnitude of childhood abuse would be associated with overlapping anterior cingulate cortex (ACC) and insular volumetric reductions, and that FND and PTSD symptoms would map onto distinct cingulo-insular areas. Methods This within-group voxel-based morphometry study probes volumetric associations with self-report measures of functional neurological symptoms, advers…

AdultMalemedicine.medical_specialtyStatistics as TopicNeurological disorderbehavioral disciplines and activitiesGyrus CinguliArticleLife Change EventsStress Disorders Post-Traumatic03 medical and health sciences0302 clinical medicineImaging Three-DimensionalInternal medicineNeuroplasticityImage Interpretation Computer-AssistedmedicinePsychogenic diseaseHumansChild AbuseGray MatterChildDominance CerebralConversion disorderAnterior cingulate cortexCerebral CortexFunctional weaknessVoxel-based morphometryOrgan SizeMiddle Agedmedicine.diseaseMagnetic Resonance ImagingPsychophysiologic Disorders030227 psychiatryPsychiatry and Mental healthmedicine.anatomical_structurenervous systemConversion DisorderCohortSurgeryFemaleNeurology (clinical)Nervous System DiseasesPsychology030217 neurology & neurosurgeryClinical psychology
researchProduct

Lower plasma testosterone levels enhance the predictive value of endothelial dysfunction for future cardiovascular events: A 5-year prospective study.

2016

LETTER TO EDITOR

AdultMalemedicine.medical_specialtyTime FactorsUrology030204 cardiovascular system & hematologySettore MED/24 - UrologiaCardiovascular events.Cohort Studies03 medical and health sciences0302 clinical medicinePredictive Value of TestsRisk FactorsInternal medicinemedicineHumansTestosterone030212 general & internal medicineEndothelial dysfunctionProspective StudiesEndothelial dysfunctionProspective cohort studyAgedAged 80 and overbusiness.industryMedicine (all)Testosterone (patch)Middle Agedmedicine.diseasePredictive valueSettore MED/11 - Malattie Dell'Apparato CardiovascolareDeathEndocrinologyCardiovascular DiseasesEndothelium VascularbusinessCardiology and Cardiovascular MedicineBiomarkersFollow-Up StudiesForecastingInternational journal of cardiology
researchProduct

Long-term effects on adult attachment in German occupation children born after World War II in comparison with a birth-cohort-matched representative …

2016

Children born of war are a phenomenon of every conflict. At the end of World War II and thereafter, approximately 400,000 children were fathered by foreign soldiers and born to local women in Germany. Quantitative research on psychosocial consequences of growing up as German occupation child (GOC) has been missing so far.This study examines adult attachment and its association with current depression in GOC (N = 146) using self-report instruments: Adult Attachment Scale, Patient Health Questionnaire. Data were compared to a birth-cohort-matched representative sample of the German population (BCMS; N = 786).GOC differ in both attachment dimensions (less comfortable with closeness/intimacy, l…

AdultMalemedicine.medical_specialtyWorld War IIPopulationPsychological Techniques050109 social psychologyGermanLife Change Events03 medical and health sciences0302 clinical medicineGermanymedicineHumans0501 psychology and cognitive sciencesPsychiatryeducationChildObject Attachmenteducation.field_of_studyPovertyDepression05 social sciencesWorld War IIObject Attachmentlanguage.human_language030227 psychiatryPatient Health QuestionnairePsychiatry and Mental healthAdult Survivors of Child Adverse EventslanguageLife course approachFemaleGeriatrics and GerontologyPshychiatric Mental HealthPsychologyGerontologyPsychosocialAgingmental health
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Able or unable to work? : Life trajectory after severe occupational injury

2018

Purpose: To study the probabilities and permanence of return to work, inability to work and rehabilitation, and to explore the connection between these life situations and later working after a sev...

AdultMalework disability030506 rehabilitationAdolescentKansanterveystiede ympäristö ja työterveys - Public health care science environmental and occupational healthmedicine.medical_treatmentOccupational injuryApplied psychologyKansantaloustiede - EconomicsReturn to workrehabilitationCohort StudiesLife Change EventsYoung Adult03 medical and health sciencesInjury Severity ScoreReturn to Work0302 clinical medicinemedicineHumansDisabled PersonsRegistriesFinlandAgedRetirementRehabilitationWork disabilityRehabilitationAge Factorsoccupational injuriesreturn to workMiddle Agedmedicine.diseaseOccupational InjuriesWork lifeConnection (mathematics)Work (electrical)UnemploymentIncomeTrajectoryFemale0305 other medical sciencePsychology030217 neurology & neurosurgery
researchProduct

Coping strategies and postpartum depressive symptoms: A structural equation modelling approach

2015

BACKGROUND: Variables such as the mother's personality, social support, coping strategies and stressful events have been described as risk factors for postpartum depression. Structural Equation Modelling (SEM) analysis was used to examine whether neuroticism, perceived social support, perceived life events, and coping strategies are associated with postpartum depressive symptoms at the 8th and 32nd weeks. METHODS: A total of 1626 pregnant women participated in a longitudinal study. Different evaluations were performed 8 and 32weeks after delivery. Several measures were used: the Edinburgh Postnatal Depression Scale (EPDS), the Diagnostic Interview for Genetic Studies (DIGS), the Eysenck Per…

AdultNeuroticismDepressionPostpartum PeriodStatistics as TopicPsychological TechniquesSocial SupportLife events/StressPersonality AssessmentPrognosisAnxiety DisordersDepression PostpartumLife Change EventsPredictive Value of TestsPregnancyRisk FactorsPostpartumAdaptation PsychologicalHumansFemaleLongitudinal StudiesCopingStress Psychological
researchProduct