Search results for "fluids"

showing 10 items of 1936 documents

Hyperfine interaction in the Autler-Townes effect: The formation of bright, dark, and chameleon states

2017

This paper is devoted to clarifying the implications of hyperfine (HF) interaction in the formation of adiabatic (i.e., ``laser-dressed'') states and their expression in the Autler-Townes (AT) spectra. We first use the Morris-Shore model [J. R. Morris and B. W. Shore, Phys. Rev. A 27, 906 (1983)] to illustrate how bright and dark states are formed in a simple reference system where closely spaced energy levels are coupled to a single state with a strong laser field with the respective Rabi frequency ${\mathrm{\ensuremath{\Omega}}}_{S}$. We then expand the simulations to realistic hyperfine level systems in Na atoms for a more general case when non-negligible HF interaction can be treated as…

PhysicsAutler–Townes effectCoupling (probability)01 natural sciencesOmegaSpectral line010305 fluids & plasmas0103 physical sciencesAtomic physics010306 general physicsGround stateHyperfine structureEnergy (signal processing)ExcitationPhysical Review A
researchProduct

Aircraft wing rock oscillations suppression by simple adaptive control

2020

Abstract Roll angular motion of the modern aircraft operating in non-linear flight modes with a high angle of attack often demonstrates the limit cycle oscillations, which is commonly known as the wing rock phenomenon. Wing rock dynamics are represented by a substantially non-linear model, with parameters varying over a wide range, depending on the flight conditions (altitude, Mach number, payload mass, etc.) and angle of attack. A perspective approach of the wing rock suppression lies in the adaptation methods. In the present paper an application of the simple adaptive control approach with the Implicit Reference Model (IRM) is proposed and numerically studied. The IRM adaptive controller …

0209 industrial biotechnologyAdaptive controlComputer scienceAngle of attackAerospace Engineering02 engineering and technology01 natural sciences010305 fluids & plasmaslaw.inventionsymbols.namesake020901 industrial engineering & automationCircular motionAileronMach numberControl theorylawRange (aeronautics)0103 physical sciencesTrajectorysymbolsAerospace Science and Technology
researchProduct

Piezoelectric Actuated Nonlinear Energy Sink With Tunable Attenuation Efficiency

2019

Abstract Comparing to linear vibration absorbers, nonlinear energy sinks (NESs) have attracted worldwide attention for their intrinsic characteristics of targeted energy transfer or energy pumping in a relatively wide frequency range. Unfortunately, they are highly dependent on the vibration amplitude to be attenuated and will play its role only if the external load exceeds a specific threshold value. Different from the passive bistable NES, a novel piezoelectric nonlinear energy sink (PNES) is designed by introducing in-phase actuation to compensate or enhance the external vibration loads, thus triggering the NES operating in high attenuation efficiency. The nonlinear mathematic model of t…

Physicsgeographygeography.geographical_feature_categoryCantileverbusiness.industryMechanical EngineeringAttenuationCondensed Matter Physics01 natural sciencesPiezoelectricitySink (geography)010305 fluids & plasmasNonlinear systemMechanics of Materials0103 physical sciencesOptoelectronicsbusiness010301 acousticsExcitationJournal of Applied Mechanics
researchProduct

Molecular surveillance of norovirus, 2005–16 : an epidemiological analysis of data collected from the NoroNet network

2018

BACKGROUND: The development of a vaccine for norovirus requires a detailed understanding of global genetic diversity of noroviruses. We analysed their epidemiology and diversity using surveillance data from the NoroNet network.METHODS: We included genetic sequences of norovirus specimens obtained from outbreak investigations and sporadic gastroenteritis cases between 2005 and 2016 in Europe, Asia, Oceania, and Africa. We genotyped norovirus sequences and analysed sequences that overlapped at open reading frame (ORF) 1 and ORF2. Additionally, we assessed the sampling date and country of origin of the first reported sequence to assess when and where novel drift variants originated.FINDINGS: W…

0301 basic medicineDatabases FactualvirusesVARIANTSmedicine.disease_causeDisease OutbreaksEMERGENCEfluids and secretions[SDV.MHEP.MI]Life Sciences [q-bio]/Human health and pathology/Infectious diseasesEpidemiologyGenotypeTOOLmedia_commonCaliciviridae InfectionsMolecular Epidemiologyvirus diseasesrespiratory system3. Good healthGastroenteritis[ SDV.MHEP.MI ] Life Sciences [q-bio]/Human health and pathology/Infectious diseasesInfectious DiseasesGeography[SDV.MP.VIR]Life Sciences [q-bio]/Microbiology and Parasitology/VirologyRNA Viral[ SDV.MHEP.HEG ] Life Sciences [q-bio]/Human health and pathology/Hépatology and GastroenterologyOUTBREAKSmedicine.medical_specialtyEUROPEGenotypeTRANSMISSIONVIRUSES[ SDV.MP.VIR ] Life Sciences [q-bio]/Microbiology and Parasitology/Virology03 medical and health sciencesSDG 3 - Good Health and Well-beingGenetic driftEnvironmental healthmedicinemedia_common.cataloged_instanceHumansEuropean unionRetrospective StudiesGenetic diversityMolecular epidemiologyNorovirusOutbreakGenetic Variation[SDV.MHEP.HEG]Life Sciences [q-bio]/Human health and pathology/Hépatology and GastroenterologyADULTSdigestive system diseasesEVOLUTION030104 developmental biology3121 General medicine internal medicine and other clinical medicineNorovirushuman activities
researchProduct

Rydberg excitation of trapped cold ions: a detailed case study

2011

We provide a detailed theoretical and conceptual study of a planned experiment to excite Rydberg states of ions trapped in a Paul trap. The ultimate goal is to exploit the strong state dependent interactions between Rydberg ions to implement quantum information processing protocols and to simulate the dynamics of strongly interacting spin systems. We highlight the promises of this approach when combining the high degree of control and readout of quantum states in trapped ion crystals with the novel and fast gate schemes based on interacting giant Rydberg atomic dipole moments. We discuss anticipated theoretical and experimental challenges on the way towards its realization.

PhysicsQuantum PhysicsAtomic Physics (physics.atom-ph)FOS: Physical sciencesGeneral Physics and Astronomy01 natural sciencesPhysics - Atomic Physics010305 fluids & plasmasIonsymbols.namesakeDipoleQuantum state0103 physical sciencesRydberg formulasymbolsPhysics::Atomic PhysicsIon trapAtomic physicsQuantum Physics (quant-ph)010306 general physicsSpin (physics)Realization (systems)ExcitationNew Journal of Physics
researchProduct

Protecting quantum resources via frequency modulation of qubits in leaky cavities

2018

Finding strategies to preserve quantum resources in open systems is nowadays a main requirement for reliable quantum-enhanced technologies. We address this issue by considering structured cavities embedding qubits driven by a control technique known as frequency modulation. We first study a single qubit in a lossy cavity to determine optimal modulation parameters and qubit-cavity coupling regime allowing a gain of four orders of magnitude concerning coherence lifetimes. We relate this behavior to the inhibition of the qubit effective decay rate rather than to stronger memory effects (non-Markovianity) of the system. We then exploit these findings in a system of noninteracting qubits embedde…

Quantum PhysicsMultidisciplinaryQuantum decoherenceComputer sciencelcsh:Rlcsh:MedicineFOS: Physical sciencesQuantum entanglementTopology01 natural sciencesSettore FIS/03 - Fisica Della Materia010305 fluids & plasmasEntanglement open quantum systems protection of quantum correlations frequency modulationQubit0103 physical scienceslcsh:Qlcsh:Science010306 general physicsQuantum Physics (quant-ph)QuantumFrequency modulationCoherence (physics)Quantum computer
researchProduct

Impacts of Varying Concentrations of Cloud Condensation Nuclei on Deep Convective Cloud Updrafts—A Multimodel Assessment

2021

AbstractThis study presents results from a model intercomparison project, focusing on the range of responses in deep convective cloud updrafts to varying cloud condensation nuclei (CCN) concentrations among seven state-of-the-art cloud-resolving models. Simulations of scattered convective clouds near Houston, Texas, are conducted, after being initialized with both relatively low and high CCN concentrations. Deep convective updrafts are identified, and trends in the updraft intensity and frequency are assessed. The factors contributing to the vertical velocity tendencies are examined to identify the physical processes associated with the CCN-induced updraft changes. The models show several c…

Convection[SDU.OCEAN]Sciences of the Universe [physics]/Ocean AtmosphereAtmospheric ScienceBuoyancy010504 meteorology & atmospheric sciencesPerturbation (astronomy)engineering.materialAtmospheric sciences01 natural sciences010305 fluids & plasmasTroposphere13. Climate action0103 physical sciencesConvective cloudengineeringCloud condensation nucleiEnvironmental scienceIntensity (heat transfer)Pressure gradient0105 earth and related environmental sciences
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Spatial localization and pattern formation in discrete optomechanical cavities and arrays

2020

We investigate theoretically the generation of nonlinear dissipative structures in optomechanical (OM) systems containing discrete arrays of mechanical resonators. We consider both hybrid models in which the optical system is a continuous multimode field, as it would happen in an OM cavity containing an array of micro-mirrors, and also fully discrete models in which each mechanical resonator interacts with a single optical mode, making contact with Ludwig & Marquardt [Phys. Rev. Lett. 101, 073603 (2013)]. Also, we study the connections between both types of models and continuous OM models. While all three types of models merge naturally in the limit of a large number of densely distribu…

PhysicsQuantum PhysicsMulti-mode optical fiberField (physics)Mode (statistics)FOS: Physical sciencesGeneral Physics and AstronomyPattern formationÒpticaTopologySolitons01 natural sciences[PHYS.PHYS.PHYS-GEN-PH]Physics [physics]/Physics [physics]/General Physics [physics.gen-ph]010305 fluids & plasmasNonlinear systemResonator0103 physical sciencesLimit (music)Dissipative systemQuantum Physics (quant-ph)010306 general physicsPhysics - OpticsOptics (physics.optics)
researchProduct

Analysis of LSD in human body fluids and hair samples applying ImmunElute columns.

2000

Immunoaffinity extraction units (LSD ImmunElute) are commercially available for the analysis of lysergic acid diethylamide (LSD) in urine. The ImmunElute resin contains immobilized monoclonal antibodies to LSD. We applied the ImmunElute procedure to serum and also to human hair samples. For hair analysis the samples were first extracted with methanol under sonication. The extracts were then purified using the ImmunElute resin. LSD analysis was carried out with HPLC and fluorescence detection. The immunoaffinity extraction provides highly purified extracts for chromatographic analysis. The limit of detection (signal-to-noise ratio = 3) has been determined to be < 50 pg regardless of which sa…

Detection limitAdultMaleChromatographyAdolescentChemistryIllicit DrugsSonicationHair analysisExtraction (chemistry)UrineHigh-performance liquid chromatographyChromatography AffinityPathology and Forensic MedicineBody FluidsSubstance Abuse DetectionLysergic Acid DiethylamideAffinity chromatographyHumansGas chromatography–mass spectrometryLawChromatography High Pressure LiquidHairForensic science international
researchProduct