Search results for "fos"

showing 10 items of 15075 documents

Photoelectron Emission from Metal Surfaces Induced by Radiation Emitted by a 14 GHz Electron Cyclotron Resonance Ion Source

2015

Photoelectron emission measurements have been performed using a room-temperature 14 GHz ECR ion source. It is shown that the photoelectron emission from Al, Cu, and stainless steel (SAE 304) surfaces, which are common plasma chamber materials, is predominantly caused by radiation emitted from plasma with energies between 8 eV and 1 keV. Characteristic X-ray emission and bremsstrahlung from plasma have a negligible contribution to the photoelectron emission. It is estimated from the measured data that the maximum conceivable photoelectron flux from plasma chamber walls is on the order of 10% of the estimated total electron losses from the plasma. peerReviewed

010302 applied physicsMaterials scienceta114Physics::Instrumentation and DetectorsAstrophysics::High Energy Astrophysical PhenomenaCyclotron resonanceBremsstrahlungFOS: Physical sciencesPlasmaElectronphotoelectron emissionRadiation01 natural sciences7. Clean energyElectron cyclotron resonanceIon sourcePhysics - Plasma Physics010305 fluids & plasmasPlasma Physics (physics.plasm-ph)Physics::Plasma Physics0103 physical scienceselectron cyclotron resonance ion sourcesPlasma diagnosticsAtomic physicsInstrumentation
researchProduct

State-space formulation of scalar Preisach hysteresis model for rapid computation in time domain

2015

A state-space formulation of classical scalar Preisach model (CSPM) of hysteresis is proposed. The introduced state dynamics and memory interface allow to use the state equation, which is rapid in calculation, instead of the original Preisach equation. The main benefit of the proposed modeling approach is the reduced computational effort which requires only a single integration over the instantaneous line segment in the Preisach plane. Numerical evaluations of the computation time and model accuracy are provided in comparison to the CSPM which is taken as a reference model.

010302 applied physicsMemory interfacePreisach model of hysteresis0209 industrial biotechnologyApplied MathematicsComputationScalar (mathematics)02 engineering and technologySystems and Control (eess.SY)01 natural sciences020901 industrial engineering & automationLine segmentControl theoryModeling and Simulation0103 physical sciencesFOS: Electrical engineering electronic engineering information engineeringApplied mathematicsComputer Science - Systems and ControlTime domainReference modelMathematics
researchProduct

High-frequency EPR study on Cu4Cu- and Co4Co-metallacrown complexes

2019

Abstract High-frequency/high-field electron paramagnetic resonance studies on two homonuclear 12-MC-4 metallacrown complexes Cu4Cu and Co4Co are presented. For Cu4Cu, our data imply axial-type g-anisotropy with g x = 2.03 ± 0.01 , g y = 2.04 ± 0.01 , and g z = 2.23 ± 0.01 , yielding g = 2.10 ± 0.02 . No significant zero field splitting (ZFS) of the ground state mode is observed. In Co4Co, we find a m S = ± 3 / 2 ground state with g = 2.66 . The data suggest large anisotropy D of negative sign.

010302 applied physicsPhysicsCondensed Matter - Materials ScienceCondensed Matter - Mesoscale and Nanoscale PhysicsMaterials Science (cond-mat.mtrl-sci)FOS: Physical sciences02 engineering and technologyZero field splitting021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesHomonuclear moleculeElectronic Optical and Magnetic Materialslaw.inventionlawMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciencesAtomic physics0210 nano-technologyGround stateElectron paramagnetic resonanceAnisotropyMetallacrownJournal of Magnetism and Magnetic Materials
researchProduct

Electromagnetically induced switching of ferroelectric thin films

2007

We analyze the interaction of an electromagnetic spike (one cycle) with a thin layer of ferroelectric medium with two equilibrium states. The model is the set of Maxwell equations coupled to the undamped Landau-Khalatnikov equation, where we do not assume slowly varying envelopes. From linear-scattering theory, we show that low-amplitude pulses can be completely reflected by the medium. Large-amplitude pulses can switch the ferroelectric. Using numerical simulations and analysis, we study this switching for long and short pulses, estimate the switching times, and provide useful information for experiments.

010302 applied physicsPhysicsCondensed matter physicsScatteringNumerical analysisThin layerFOS: Physical sciencesPattern Formation and Solitons (nlin.PS)Condensed Matter Physics01 natural sciencesFerroelectricityNonlinear Sciences - Pattern Formation and SolitonsElectronic Optical and Magnetic Materialssymbols.namesakeAmplitudeMaxwell's equations0103 physical sciencessymbolsFerroelectric thin filmsThin film010306 general physicsComputingMilieux_MISCELLANEOUS
researchProduct

Commissioning of the vacuum system of the KATRIN Main Spectrometer

2016

The KATRIN experiment will probe the neutrino mass by measuring the β-electron energy spectrum near the endpoint of tritium β-decay. An integral energy analysis will be performed by an electro-static spectrometer (``Main Spectrometer''), an ultra-high vacuum vessel with a length of 23.2 m, a volume of 1240 m[superscript 3], and a complex inner electrode system with about 120 000 individual parts. The strong magnetic field that guides the β-electrons is provided by super-conducting solenoids at both ends of the spectrometer. Its influence on turbo-molecular pumps and vacuum gauges had to be considered. A system consisting of 6 turbo-molecular pumps and 3 km of non-evaporable getter strips ha…

010302 applied physicsPhysicsLight nucleusPhysics - Instrumentation and DetectorsSpectrometerSpectrometersPhysics::Instrumentation and DetectorsVacuum-basedFOS: Physical sciencesInstrumentation and Detectors (physics.ins-det)01 natural sciencesEnergy analysisNuclear physics0103 physical sciencesEnergy spectrumGas systems and purificationNeutrino detectorsddc:620010306 general physicsInstrumentationMathematical PhysicsEngineering & allied operationsKATRINdetectors
researchProduct

Permanent magnet system to guide superparamagnetic particles

2017

A new concept of permanent magnet systems for guiding superparamagnetic particles on arbitrary trajectories is proposed. The basic concept is to use one magnet system with a strong and homogeneous (dipolar) magnetic field to magnetize and orient the particles. A second constantly graded field (quadrupolar) is superimposed to the first to generate a force. In this configuration the motion of the particles is driven solely by the component of the gradient field which is parallel to the direction of the homogeneous field. Then the particles are guided with constant force in a single direction over the entire volume. The direction can be adjusted by varying the angle between quadrupole and dipo…

010302 applied physicsPhysicsMagnetic momentCondensed matter physicsFOS: Physical sciences02 engineering and technologyMechanics021001 nanoscience & nanotechnologyCondensed Matter PhysicsPolarization (waves)Physics - Medical Physics01 natural sciencesElectronic Optical and Magnetic MaterialsMagnetic fieldDipoleMagnet0103 physical sciencesQuadrupoleVector fieldMedical Physics (physics.med-ph)0210 nano-technologyQuadrupole magnetJournal of Magnetism and Magnetic Materials
researchProduct

Multiscale model approach for magnetization dynamics simulations

2016

Simulations of magnetization dynamics in a multiscale environment enable the rapid evaluation of the Landau-Lifshitz-Gilbert equation in a mesoscopic sample with nanoscopic accuracy in areas where such accuracy is required. We have developed a multiscale magnetization dynamics simulation approach that can be applied to large systems with spin structures that vary locally on small length scales. To implement this, the conventional micromagnetic simulation framework has been expanded to include a multiscale solving routine. The software selectively simulates different regions of a ferromagnetic sample according to the spin structures located within in order to employ a suitable discretization…

010302 applied physicsPhysicsMesoscopic physicsMagnetization dynamicsCondensed Matter - Mesoscale and Nanoscale PhysicsScale (ratio)DiscretizationAttenuationFOS: Physical sciencesComputational Physics (physics.comp-ph)01 natural sciencesSpin waveMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciencesStatistical physics010306 general physicsPhysics - Computational PhysicsNanoscopic scaleSpin-½Physical Review B
researchProduct

System for control of polarization state of light and generation of light with continuously rotating linear polarization

2019

We present a technique for generating light in an arbitrary polarization state. The technique is based on interference of two orthogonally polarized light beams, whose amplitudes and phases are controlled with a Mach-Zehnder inteferometer with acousto-optic modulators (AOMs) placed in each arm. We demonstrate that via control over amplitudes, phases, and frequencies of acoustic waves driving the AOMs, any polarization state can be synthesized. In particular, we demonstrate generation of linearly polarized light, whose polarization plane continuously rotates at a rate from 1 kHz to 1 MHz. Such light finds applications in science (e.g., investigations of Bloch-Siegert effect) and technology (…

010302 applied physicsPhysicsPolarization planebusiness.industryLinear polarizationMagnetometerLinearly polarized lightFOS: Physical sciencesAcoustic wavePhysics - Applied PhysicsApplied Physics (physics.app-ph)Polarization (waves)01 natural sciences010305 fluids & plasmaslaw.inventionAmplitudeOpticslaw0103 physical sciencesOptical rotationbusinessInstrumentationPhysics - OpticsOptics (physics.optics)
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Topological two-dimensional Su–Schrieffer–Heeger analog acoustic networks: Total reflection at corners and corner induced modes

2021

In this work, we investigate some aspects of an acoustic analogue of the two-dimensional Su-Schrieffer-Heeger model. The system is composed of alternating cross-section tubes connected in a square network, which in the limit of narrow tubes is described by a discrete model coinciding with the two-dimensional Su-Schrieffer-Heeger model. This model is known to host topological edge waves, and we develop a scattering theory to analyze how these waves scatter on edge structure changes. We show that these edge waves undergo a perfect reflection when scattering on a corner, incidentally leading to a new way of constructing corner modes. It is shown that reflection is high for a broad class of edg…

010302 applied physicsPhysics[PHYS]Physics [physics]Total internal reflectionWork (thermodynamics)Condensed Matter - Mesoscale and Nanoscale PhysicsScatteringGeneral Physics and AstronomyClassical Physics (physics.class-ph)FOS: Physical sciencesPhysics - Classical Physics02 engineering and technologyEdge (geometry)021001 nanoscience & nanotechnologyTopology01 natural sciencesSquare (algebra)0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)Reflection (physics)Limit (mathematics)Scattering theory0210 nano-technologyComputingMilieux_MISCELLANEOUS
researchProduct