Search results for "home"

showing 10 items of 3036 documents

Taxonomy and conservation ofPancratium maritimum(Amaryllidaceae) and relatives in the Central Mediterranean

2015

Pancratium maritimum L. (Amaryllidaceae) is a geophyte occurring in the Mediterranean region, from the Black Sea to part of the Atlantic coast. This plant is receiving much attention from the international scientific community due to its value as a bioindicator, the potential industrial value of its chemical compounds, and its use as a commercial ornamental plant. Plant morphometry and sequences of three plastid DNA regions (rbcL, matK, trnH-psbA) were used to assess the phenotypic and genetic variability of this taxon and its closest congeneric species (in particular Pancratium linosae, from the volcanic island of Linosa) in the Central Mediterranean (Sicily, Tunisia and surrounding island…

molecular markerMediterranean climatesea daffodilbiologyPancratium maritimumEcologySettore BIO/02 - Botanica SistematicaPancratiumPlant ScienceAmaryllidaceaebiology.organism_classificationTaxongenetic variabilitySettore BIO/03 - Botanica Ambientale E ApplicataBotanyDNA barcodingTaxonomy (biology)Gene poolGenetic variabilitymorphometryActa Botanica Gallica
researchProduct

Virtual Exchange: Future-ready teaching of multiliteracies across borders and cultures

2020

Virtual exchange is an online form of internationalization at home. Students from different countries collaborate in small, international groups on tasks joined by a common theme. They combine their expertise when solving problems together. The teachers act as mentors, providing facilitation and support for the students during the virtual exchange. The student teams work independently by selecting the tools for the collaboration, allocating the tasks and creating the group’s final product. Virtual exchange is a transnational learning opportunity which enables students to learn and practice how to efficiently combine and make use of their digital, visual, critical, linguistic and intercultur…

monilukutaitomultiliteracieskulttuurienvälinen vuorovaikutusonline learningworking life skillstyöelämävalmiudetopiskelijavaihtoVirtual Exchangeintercultural collaborationverkko-oppiminenkansainvälistymineninternationalization at home
researchProduct

Dampness and student-reported social climate: two multilevel mediation models.

2021

Background Little previous research has analysed the relationship between schools' indoor air problems and schools' social climate. In this study, we analysed a) whether observed mould and dampness in a school building relates to students' perceptions of school climate (i.e. teacher-student relationships and class spirit) and b) whether reported subjective indoor air quality (IAQ) at the school level mediates this relationship. Methods The data analysed was created by merging two nationwide data sets: survey data from students, including information on subjective IAQ (N = 25,101 students), and data from schools, including information on mould and dampness in school buildings (N = 222). The …

mouldMaledampnessAdolescenteducationkosteusvauriotIndoor environmental problemsteacher-student relationshipsMultilevel analysislcsh:RC963-969HumansIndoor air qualityStudentsopettaja-oppilassuhdeMouldrakennuksetSchoolskoulutNegotiatingsisäilmalcsh:Public aspects of medicineResearchFungiClass spiritlcsh:RA1-1270Humidityhomeilmapiiri3142 Public health care science environmental and occupational healthTeacher-student relationshipsSocial ConditionskoulurakennuksetAir Pollution Indoor5141 Sociologyindoor environmental problemslcsh:Industrial medicine. Industrial hygieneclass spiritmultilevel analysisFemaleDampnessindoor air qualityEnvironmental health : a global access science source
researchProduct

Training practices of Filipino athletes during the early covid-19 lockdown

2022

The imposition of COVID-19 lockdown restricted the daily activities of many people, including athletes. This study investigated the training practices of athletes in the Philippines during the first COVID-19 lockdown. A total of 442 athletes answered an online survey (May-July 2020), with questions pertaining to training practices, such as training frequency and duration. Data were analyzed according to: athlete classification (world-class, international, national, state, or recreational), sport category (individual or team), and sex (male or female). During lockdown, significant reductions in training frequency (except recreational, i.e., lower pre-lockdown training) and duration were obse…

movement restriction ; home training ; remote training ; sports training ; SARS-CoV-2movement restriction home training remote training sports training SARS-CoV-2sports trainingremote trainingSARS-CoV-2home trainingmovement restriction; home training; remote training; sports training; SARS-CoV-2Physical Therapy Sports Therapy and Rehabilitationmovement restriction
researchProduct

Posttraumatic Propofol Neurotoxicity Is Mediated via the Pro–Brain-Derived Neurotrophic Factor-p75 Neurotrophin Receptor Pathway in Adult Mice*

2016

Objectives:The gamma-aminobutyric acid modulator propofol induces neuronal cell death in healthy immature brains by unbalancing neurotrophin homeostasis via p75 neurotrophin receptor signaling. In adulthood, p75 neurotrophin receptor becomes down-regulated and propofol loses its neurotoxic effect. H

musculoskeletal diseases0301 basic medicineBrain-derived neurotrophic factorProgrammed cell deathbiologybusiness.industryNeurotoxicityCaspase 3PharmacologyCritical Care and Intensive Care Medicinemedicine.disease03 medical and health sciences030104 developmental biology0302 clinical medicinenervous systemAnesthesiamedicinebiology.proteinLow-affinity nerve growth factor receptorReceptorbusiness030217 neurology & neurosurgeryHomeostasisNeurotrophinCritical Care Medicine
researchProduct

Effectiveness of a 12-month home-based exercise program on trunk muscle strength and spine function after lumbar spine fusion surgery:a randomized co…

2022

Purpose: The effectiveness of a 12-month home-exercise program on trunk muscle strength after lumbar spine fusion surgery was evaluated. Materials and methods: Three months postoperatively, 98 patients were randomized either to the exercise group (EG), with a progressive 12-month home-based exercise program, or to usual care group (UCG), with one guidance session for light home-exercises. Maximal trunk muscle strength was measured by a strain-gauge dynamometer and trunk extensor endurance was measured by Biering-Sørensen’s test at baseline and after the intervention. Results: The mean change in extension strength during the intervention was 75 N in EG and 58 N in UCG. Flexion strength impro…

musculoskeletal diseases030506 rehabilitationmedicine.medical_specialtyLumbar spine fusionspondylolisteesimedicine.medical_treatmentfysioterapiarehabilitationlaw.inventionspine surgery03 medical and health sciences0302 clinical medicineselkärankaRandomized controlled triallawmedicineHumansMuscle StrengthMuscle SkeletalHome based exerciselääkinnällinen kuntoutusphysiotherapyspondylolisthesisRehabilitationexercisebusiness.industryRehabilitationTorsomedicine.diseaseSpondylolisthesisExercise TherapySurgerySpine (zoology)Spinal Fusionmuscle strengthMuscle strengthlumbar spine fusionlihaskunto0305 other medical scienceTrunk musclebusiness030217 neurology & neurosurgeryliikuntahoito
researchProduct

Novel Digital Technique to Quantify the Area and Volume of Cement Remaining and Enamel Removed after Fixed Multibracket Appliance Therapy Debonding: …

2020

The aim of this study was to construct a novel, repeatable, reproducible, and accurate measurement protocol for the area and volume of the remaining cement after removal of fixed multibracket appliances, the area and volume of remaining cement after cement removal, the area and volume of enamel removed after cement removal, and the volume of cement used to adhere fixed multibracket appliances. A total of 30 brackets were cemented and removed with over 30 extracted teeth embedded into three experimental models of epoxy resin. The models were scanned before and after bracket placement, bracket debonding, and polishing the remaining cement. The brackets were submitted to micro-computed tomogra…

musculoskeletal diseaseslcsh:MedicineCementos dentales.Orthodontics.Article03 medical and health sciences0302 clinical medicineDientes - Anomalías y malformaciones - Tratamiento.Teeth - Abnormalities - Treatment.Dental cement0502 economics and businessOrtodoncia.In vitro studyMedicineMateriales dentales.Dental therapeutics - Equipment and supplies.CementTerapéutica dental - Aparatos y material.ReproducibilityDental enamel.Enamel paintDental cements.business.industryenamel removedlcsh:R05 social sciencesBrackettechnology industry and agriculturegeomorphometryalignment030206 dentistryGeneral MedicineRepeatabilityequipment and suppliesEsmalte dental.surgical procedures operativecement remainingvisual_artdigital impressionvisual_art.visual_art_medium050211 marketingDental materials.businessorthodonticsBiomedical engineeringVolume (compression)Journal of Clinical Medicine
researchProduct

Systematic Use of Song and Music in Dementia Care: Health Care Providers’ Experiences

2020

Background and Aim Using song and music in a systematic way in residential dementia care may have several positive impacts on the patients, as well as the care providers. The aim of this study was to explore how health care providers experienced taking responsibility for conducting a song and music program in dementia care in nursing homes. Methods An explorative, qualitative study design was used. Focus groups were formed by 17 health care providers from 3 different nursing homes. These providers had experience implementing and using the “Gjenklang” (“reverberation”) song and music program especially developed for people with dementia. Focus group interviews were transcribed verbatim, and …

music programfocus group interviewsVDP::Medisinske Fag: 700::Helsefag: 800music therapyqualitativenursing homeshumanitiesOriginal Researchdementia
researchProduct

Bringing madness home : the multiple meanings of home in Janet Frame's Faces in the water, Bessie Head's A question of power and Lauren Slater's Proz…

2012

naisetkirjallisuusomaelämäkerrallisuusliteraturekotiaiheethomespacepsychiatrymielenterveyspsykiatrinen hoitomielenterveyshäiriötgenderhulluuswomen's madnessbelongingFeministinen kirjallisuudentutkimus
researchProduct

Tarina, joka on koettava : narratiivisten tutkimispelien taustat, tarinat ja kerronta

2015

Pro gradu -työssäni tutkin narratiivisia tutkimispelejä, joka on uusi ja vasta vähän tutkittu digitaalisten pelien genre. Tutkielmani on muodoltaan artikkeligradu, joka koostuu kolmesta artikkelista sekä Johdanto- ja Yhteenveto-luvuista. Ensimmäisessä artikkelissa esittelen narratiivisten tutkimispelien genreä, sen taustaa ja tärkempiä genreen kuuluvia pelejä. Lisäksi luon määritelmän narratiivisten tutkimispelien genrelle osoittamalla yhteisiä ominaispiirteitä kahdeksasta pelistä, joiden katson edustavan kyseistä genreä. Tarkastelemani narratiiviset tutkimispelit ovat kaikki uusia, vuosina 2012–2015 ilmestyneitä, lukuun ottamatta vuonna 1993 ilmestynyttä klassikkopeliä Myst, joka voidaan n…

narratiiviset tutkimispelitpelitnarratiivisuuskerrontaGone HomeThe Vanishing of Ethan Carterpelitutkimusdigitaaliset pelitepäluonnollinen narratologia
researchProduct