Search results for "infarction"

showing 10 items of 1208 documents

Cecal trap: CT findings of isolated cecal necrosis

2016

Learning objectives Background Findings and procedure details Conclusion Personal information References

genetic structuresGastrointestinal tractIschaemia / InfarctioneducationAbdomenEmergencyCT cecal necrosisAcuteContrast agent-intravenousSettore MED/36 - Diagnostica Per Immagini E RadioterapiaCT
researchProduct

IN-HOSPITAL COMPLICATIONS OF ACUTE MYOCARDIAL INFARCTION IN HYPERTENSIVE SUBJECTS

2005

BACKGROUND: Recent studies have shown a worse in-hospital outcome in hypertensive than in normotensive patients with acute myocardial infarction (AMI), which has been attributed to more frequent complications. The aim of this study was to investigate clinical patterns, risk factors, and in-hospital complications in hypertensive and normotensive patients with AMI. METHODS: Of 4994 consecutive patients with AMI admitted to the intensive care unit, hypertensive patients with first infarction (n = 915; mean age 68.8 +/- 11.4 years) and 915 gender- and age-matched normotensive subjects were retrospectively studied. RESULTS: In the univariate analysis, hypertensive subjects presented more frequen…

hypertension myocardial infaction compllicationsacute myocardial infarction
researchProduct

Nitric oxide metabolites (nitrite and nitrate) in several clinical condition.

2013

We determined the concentration of nitric oxide metabolites (NO2-+NO3-), expressed as NOx, in several clinical conditions. Regarding this, we have examined 25 subjects with arterial hypertension, 41 subjects with chronic kidney disease in conservative treatment, 106 subjects with metabolic syndrome subdivided according to the presence (n = 43) or not (n = 63) of diabetes mellitus, 48 subjects with obstructive sleep apnea syndrome (OSAS), 14 women with systemic sclerosis complicated with Raynaud's phenomenon, 42 dialyzed subjects and 105 young subjects with acute myocardial infarction (AMI). In subjects with arterial hypertension, chronic kidney disease, metabolic syndrome, systemic sclerosi…

inorganic chemicalsAdultMaledialysimedicine.medical_specialtysistemic sclerosiPhysiologykidney diseasemedicine.medical_treatmentNOxNitric OxideAMIRisk FactorsPhysiology (medical)Internal medicineDiabetes mellitusmedicineDiabetes MellitusHumansMyocardial infarctionRenal Insufficiency ChronicDialysisNitritesMetabolic SyndromeNitratesbusiness.industryOSASApneaHematologyrespiratory systemMiddle Agedmedicine.diseaseObstructive sleep apneaEndocrinologyNOx; hypertension; kidney disease; metabolic syndrome; OSAS; sistemic sclerosis; dialysis; AMICardiovascular DiseasesCase-Control StudiesHypertensionCardiologyFemalemedicine.symptomMetabolic syndromeCardiology and Cardiovascular MedicinebusinessHypopneaKidney diseaseClinical hemorheology and microcirculation
researchProduct

Acute and spontaneous coronary thrombosis in non-culprit artery during percutaneous coronary intervention in myocardial infarction with ST-segment el…

2015

lcsh:Diseases of the circulatory (Cardiovascular) systemmedicine.medical_specialtyAcute coronary syndromeTicagrelorCardiac & Cardiovascular Systemsmedicine.medical_treatmentAbciximabArticleSTEMICoronary thrombosisInternal medicinemedicineAbciximabST segmentMyocardial infarctionbusiness.industryPercutaneous coronary interventionPCImedicine.diseaselcsh:RC666-701Conventional PCICardiologyAcute coronary syndromeCardiology and Cardiovascular MedicinebusinessTicagrelorAcute and spontaneous occlusion of LADmedicine.drugIJC Heart & Vasculature
researchProduct

Plasma Viscosity and NLR in Young Subjects with Myocardial Infarction: Evaluation at the Initial Stage and at 3 and 12 Months

2018

In the “Sicilian study on juvenile myocardial infarction,” we had evaluated plasma viscosity (PV) and neutrophil/lymphocyte ratio (NLR) in patients with acute myocardial infarction (AMI) at the age of ⩽45 years. Now, we examined the relationship between these 2 parameters in 120 subjects (109 men and 11 women) aged ⩽45 years with recent AMI. The patients were classified according to the number of cardiovascular risk factors, the electrocardiographic criteria (ST-segment elevation myocardial infarction [STEMI] or non-ST-segment elevation myocardial infarction [NSTEMI]), and the extent of coronary stenosis, evaluated with coronary angiography. On fasting venous blood, we measured PV at the sh…

lcsh:Diseases of the circulatory (Cardiovascular) systemmedicine.medical_specialtySettore MED/09 - Medicina Internabusiness.industryLymphocytefungimedicine.diseaseneutrophil lymphocyte ratiomedicine.anatomical_structurelcsh:RC666-701Internal medicinecardiovascular systemCardiologyMedicineplasma viscosityIn patientcardiovascular diseasesMyocardial infarctionjuvenile myocardial infarctionStage (cooking)Cardiology and Cardiovascular MedicinebusinessPlasma viscosityOriginal ResearchClinical Medicine Insights: Cardiology
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Variations in plasma lipids and in the LDL peak particle size after acute myocardial infarction

2002

lipids LDL acute myocardial infarction
researchProduct

The Impact of Prescribed Dosage Assumptions on the Evaluation of Adherence and Persistence to Medication in Patients After Acute Myocardial Infarction

2021

Medication adherence is a significant problem in public health. Prescription-level pharmacy databases have great potential for monitoring actual drug adherence patterns at the healthcare system level. Many research papers have reported adherence estimates in different settings and populations. However, comparison between studies is not always straightforward due to different approaches taken when computing adherence. A crucial component to accurately estimate adherence is the availability of days’ supply information for each dispensing event. Reasonable assumptions regarding medication dosage have to be made, when this information is not available. In this study, we evaluate adherence and p…

medicine.medical_specialty020205 medical informaticsbusiness.industryMedication adherencePharmacy02 engineering and technologyDrug adherencemedicine.diseasePersistence (computer science)Defined daily dose0202 electrical engineering electronic engineering information engineeringmedicineIn patientMyocardial infarctionIntensive care medicinebusinessHealthcare system
researchProduct

Comparison of frequency domain measures based on spectral decomposition for spontaneous baroreflex sensitivity assessment after Acute Myocardial Infa…

2021

Abstract The objective of this study is to present a new method to assess in the frequency domain the directed interactions between the spontaneous variability of systolic arterial pressure (SAP) and heart period (HP) from their linear model representation, and to apply it for studying the baroreflex control of arterial pressure in healthy physiological states and after acute myocardial infarction (AMI). The method is based on pole decomposition of the model transfer function and on the following evaluation of causal measures of coupling and gain from the poles associated to low frequency (0.04−0.15 Hz) oscillatory components. It is compared with traditional non-causal approaches for the sp…

medicine.medical_specialty0206 medical engineeringBiomedical EngineeringHealth Informatics02 engineering and technologyAcute myocardial infarctionBaroreflexSettore ING-INF/01 - ElettronicaMatrix decomposition03 medical and health sciences0302 clinical medicineInternal medicinemedicineSpectral analysiscardiovascular diseasesMyocardial infarctionSensitivity (control systems)Spectral decompositionbusiness.industryHead-up tiltLinear modelBaroreflexmedicine.disease020601 biomedical engineeringFrequency domainCausalityBlood pressureFrequency domainCardiovascular controlSignal ProcessingSettore ING-INF/06 - Bioingegneria Elettronica E InformaticaCardiologybusiness030217 neurology & neurosurgery
researchProduct

0134 : Atrial fibrillation is associated with a marker of endothelial function and oxidative stress in patients with acute myocardial infarction

2016

Background Atrial fibrillation (AF), whether silent or symptomatic, is a frequent and severe complication of acute myocardial infarction (AMI). Asymmetric dimethylarginine (ADMA), an endogenous eNOS inhibitor, is a risk factor for endothelial dysfunction. We addressed the relationship between ADMA plasma levels and AF occurrence in AMI. Methods 273 patients hospitalized for AMI were included. Continuous electrocardiographic monitoring (CEM) e48 hours was recorded and ADMA was measured by High Performance Liquid Chromatography on admission blood sample. Results The incidence of silent and symptomatic AF was 39(14%) and 29 (11%), respectively. AF patients were markedly older than patients wit…

medicine.medical_specialty030204 cardiovascular system & hematology03 medical and health scienceschemistry.chemical_compound0302 clinical medicine[SDV.MHEP.CSC]Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemInternal medicineHeart ratemedicine030212 general & internal medicineMyocardial infarctionEndothelial dysfunctionRisk factorComputingMilieux_MISCELLANEOUSEjection fractionbusiness.industryIncidence (epidemiology)Atrial fibrillationEndothelial function[ SDV.MHEP.CSC ] Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemmedicine.diseaseAtrial fibrillation3. Good healthMyocardial infarctionchemistryCardiologyCardiology and Cardiovascular MedicineAsymmetric dimethylargininebusiness
researchProduct