Search results for "informal"

showing 10 items of 176 documents

Piazzetta Mediterraneo, Palermo

2020

Nello scenario post-crisi attuale, che ha visto la sensibile riduzione delle risorse pubbliche per i progetti di rigenerazione urbana, in molte realtà urbane italiane e non solo, stiamo assistendo alla crescita di una serie di pratiche urbane micro-spaziali che stanno ridisegnando gli spazi urbani. In questo quadro generale, particolarmente significative risultano le esperienze di rigenerazione avviate a Palermo in cui lo spazio pubblico urbano risulta essere l’esito di pratiche informali avviate dagli abitanti e, successivamente, “riconosciute” dalle politiche urbane ufficiali dell’Amministrazione comunale. In particolare, il contributo presenta l’esperienza di Piazzetta del Mediterraneo, …

Urban regenerationInformal practicesSpazio pubblicoPublic spacePratiche informaliSettore ICAR/21 - UrbanisticaRigenerazione urbana
researchProduct

Informal and Formal Practices within the EU Security Approach in Kosovo

2018

The hesitant path of Western Balkans towards EU’s integration, the enduring borders and constitutional disputes and the unsettled ethnic tensions in the region trigger new security threats for Europe. The chapter explores the link between informal and formal actors and rules in EU security domain choosing as a case study, EULEX, the Common Security and Defence Policy (CSDP) operation in Kosovo. The chapter addresses the following questions: how pragmatically EULEX has transformed itself reacting to operational needs in the field? Which is the framework of mobilization of informal networks, the source of their legitimacy and the ways they affect formal and international policies in high-inst…

Western Balkans EULEX Formal and informal practices CSDPSettore SPS/04 - Scienza Politica
researchProduct

L'aide à un parent âgé, seul et dépendant : déterminants structurels et interactions

2016

With population ageing, the demand for home care of the disabled elderly is increasing and a large part of care is provided by informal caregivers. This paper focuses on the determinants of care provision by children to an old, single and disabled parent. We focus on two-child families and apply a semi-structural methodology, already implemented on European data (survey SHARE). It makes it possible to distinguish between two types of determinants: structural determinants (individual, parental and family characteristics) and interactions (effect of the care provision of one child on the care provision of the other). The estimation of this model on data of the French survey "Handicap Santé Mé…

[SHS.STAT]Humanities and Social Sciences/Methods and statistics[SHS.DEMO] Humanities and Social Sciences/Demographylong-terme careaide informelle[SHS.DEMO]Humanities and Social Sciences/Demography[SHS.ECO]Humanities and Social Sciences/Economics and FinanceJEL : J - Labor and Demographic Economics/J.J1 - Demographic Economics/J.J1.J14 - Economics of the Elderly • Economics of the Handicapped • Non-Labor Market Discriminationpersonnes âgées dépendantesinformal care[MATH.MATH-ST]Mathematics [math]/Statistics [math.ST]interactions sociales[SHS.STAT] Humanities and Social Sciences/Methods and statisticsJEL: J - Labor and Demographic Economics/J.J1 - Demographic Economics/J.J1.J14 - Economics of the Elderly • Economics of the Handicapped • Non-Labor Market Discrimination[ SHS.ECO ] Humanities and Social Sciences/Economies and financessocial interactions[ MATH.MATH-ST ] Mathematics [math]/Statistics [math.ST][ SHS.DEMO ] Humanities and Social Sciences/Demography[SHS.ECO] Humanities and Social Sciences/Economics and Finance[ SHS.STAT ] Humanities and Social Sciences/Methods and statistics[MATH.MATH-ST] Mathematics [math]/Statistics [math.ST]
researchProduct

La terza via. Nuove regole per trasformare gli spazi aperti nella città pubblica

2014

La tesi secondo la quale i numerosi ed ampli spazi aperti della città pubblica sono tra i luoghi essenziali da cui partire per innescare trasformazioni urbane d’ampio respiro è oggi riconosciuta e ben fondata. Tuttavia al pesante corpus di riflessioni teoriche (ed anche di operazioni reali) effettuate a riguardo, non corrisponde ancora una risposta adeguata in termini procedurali e di definizione delle categorie d’azione possibili e legittime. Tale mancanza pesa sulla possibilità di intervenire in maniera veloce ed adeguata in questi luoghi. Cominciare a riflettere su nuove regole che accolgano e, insieme, normino l’entusiasmo e il successo dimostrato da tante esperienze di trasformazioni i…

architetture effimereSettore ICAR/15 - Architettura Del Paesaggiopaesaggi informalipolitiche disciplinate
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

Young Men in Digital Culture: A New Form of Informal Learning?

2012

In this chapter, the interest lies in the role of the media in young people’s and young adults’ everyday life. Of special interest is the idea of virtual environments as a learning environment, because the aspects of media, virtual realities and learning are socially important and scientifically challenging. In the analysis, three main areas are taken into consideration: First, the discussion on new learning models; second, the progress of information technology; and third, the gap between the styles of learning inside and outside the school. The study focused on young men who practically live in the online world, either playing or talking with each other via online gaming and social portal…

business.industryLearning environmentPedagogyInformation technologyThe InternetSociologySpecial Interest GroupInformal educationInformal learningEveryday lifebusinessNew media
researchProduct

Città informali, città dell'esclusione: responsabilità disciplinari nella ricerca e nella pratica

2011

Il contributo affronta il tema della città informale cercando di comprendere in che modo sia possibile affrontare le nuove sfide poste dalla città dei PVS e, più in generale dalla città contemporanea, che manifesta un sempre più accentuato divario fra gli have e gli have nots.

città informali esclusione self helpSettore ICAR/21 - Urbanistica
researchProduct

Turning Right/Turning Left? : A Neoclassical Socioeconomic Query of the Arts Signaled by Museum and Branding in Finland

2016

ABSTRACTThe Guggenheim Helsinki Plan indicated a wishful turn of the arts and culture in Finland from the socio-democratic tradition of a welfare society towards a further neoliberalism. Following the Finnish historical timeline and from a museological viewpoint, this article reviews how national identity was built through the arts, which later integrated into formal and informal education to enhance human capital. This instrumental view now promotes the idea of useful art to fuel an innovation economy of advanced technology. Considering embarking on the intricate platform of arts, economics, and finance through Guggenheim, rethinking the contemporary art market mechanism may prove to be be…

cultural identitymuseologiaVisual Arts and Performing ArtsStrategy and Managementcultural economybrändäys0211 other engineering and technologies0507 social and economic geographyart marketneoliberalism02 engineering and technologyuusliberalismiInformal educationThe artsVisual arts educationContemporary artArts in educationVisual artstaidekasvatusart historymuseologyta616Sociologyarts managementkulttuuripolitiikka05 social sciences021107 urban & regional planningbrandingArts administrationcultural policyPolitical economytaidehistoriaart educationEconomics of the arts and literature050703 geographyLawkulttuuri-identiteettiCultural policyJournal of Arts Management, Law, and Society
researchProduct

Transmission processes of indigenous Pedi music

2017

There has been unsatisfactory integration of traditional music into education, despite the fact that the Ministry of Education advocates its use, stating that education should ‘preserve South Africa’s cultural practice; develop an appreciation for the practice of one’s culture; and develop a sense of respect for other people’s culture’. South Africa is in need of a music education philosophy that is culturally embedded, cognisant of the societal context in which it is to function, and informed by South African ideas and philosophy of life. This study entails sourcing the Ethnomusicological and Anthropological focus in musicology for purposes of providing a better understanding on music and …

cultural identitymusiikkikasvatustraditiooppiminenmusiikkiLimpopoperinnemusiikkiMusical ArtSouth Africapedi-kulttuuriindigenous musicSekhukhuneinformal learningPedi culturetransmissionmusiikkikulttuurimusic and identityopetuskulttuuriperintöinformaali oppiminenenculturationsosialisaatioalkuperäiskansatuskonnollinen musiikkiEtelä-Afrikkakulttuuri-identiteetti
researchProduct

Moving forward sustainably : material and social conditions of electronic waste management in Nigeria

2018

This dissertation focuses on understanding the social material interaction between e-waste and e-scrappers for sustainable management of e-waste. Previous studies mainly concentrate on the detrimental environmental impact of e-scrappers activities, the economic and political influences of e-waste on the e-scrappers, the material flow of e-waste and the exportation of valuable e-waste extracts from highly industrialized countries to less industrialized countries. The aim of the dissertation is therefore to extend the scope of the previous studies by investigating the social material interaction between e-scrappers and e-waste. To achieve this aim, this study examines the following research q…

e-waste managementammattiyhdistysliikee-scrappersjätteetinformal recyclinge-wasteverkostoituminenNigeriajätehuoltososiaalinen asemaglobaali hallintakolmas sektorielektroniikkasähkö- ja elektroniikkaromumaailmanlaajuiset ongelmatkierrätys
researchProduct