Search results for "infrastructure"

showing 10 items of 326 documents

Data storage infrastructure laboratory

2021

El material ha obtingut un premi Fernando Sapiña del SPL. El material correspon a la part experimental de l'assignatura Infraestructura d'Emmagatzematge de Dades, de segon curs del Grau en Ciència de Dades de la Universitat de València. El material està dividit en una introducció, una pràctica 0 a realitzar a casa, i 7 sessions a realitzar en el laboratori de l'assignatura. Les pràctiques es realitzen amb una màquina virtual Linux, que es pot descarregar pels i les estudiants. A la sessió 0 es realitza la instal·lació de la màquina virtual i s'introdueixen les primeres instruccions del intèrpret d’ordres . En la sessió 1 s'aprofundeix en l’intèrpret d’ordres, passant-se en la sessió 2 a org…

storage infrastructuresystem administrationUNESCO::MATEMÁTICAS::Ciencia de los ordenadores::Informáticadata science
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

Health care and cyber threats

2019

ta113critical infrastructurecyber threatkyberuhkaterveydenhuoltocyber securitykyberturvallisuushealth carekriittinen infrastruktuuriFinnish Journal of eHealth and eWelfare
researchProduct

Towards the cyber security paradigm of ehealth: Resilience and design aspects

2017

Digital technologies have significantly changed the role of healthcare clients in seeking and receiving medical help, as well as brought up more cooperative policy issues in healthcare cross-border services. Citizens continue to take a more co-creative role in decisions about their own healthcare, and new technologies can enable and facilitate this emergent trend. In this study, healthcare services have been intended as a critical societal sector and therefore healthcare systems are focused on as critical infrastructures that ought to be protected from all types of fears, including cyber security threats and attacks. Despite continual progress in the systemic risk management of cyber domain…

ta113e-healthcareEmerging technologiesbusiness.industrycyber securityComputer securitycomputer.software_genreAnticipation (artificial intelligence)Critical information infrastructureHealth careSystemic riskeHealthBusinessteleterveydenhuoltoResilience (network)kyberturvallisuuscomputerHealthcare system
researchProduct

Embedding “roadside equipment” into environmental assessment of transportation system: the case of safety barriers

2015

The work arises from the consideration that the environmental impact of a road cannot be limited to the analysis of its constituent materials, even if correctly analyzed in their life cycle. In fact, a given road not only consists of the pavement and subgrade, but also includes several different components and accessories (e.g. road marking, drainages, safety barriers, etc.) that contribute to set a road infrastructure in operative conditions. As a matter of fact, only limited attention has been paid in the scientific literature to roadside components, unlike pavement and traffic flow. In the present work, the environmental burden of one of these components, i.e. the safety barrier, has bee…

traffic flowSettore ING-IND/11 - Fisica Tecnica AmbientaleLife cycle analysis (LCA)Life cycle analysis (LCA); guardrail road infrastructure; traffic flow; environmental impactguardrail road infrastructureenvironmental impact
researchProduct

Liikenneinfrastruktuurihankkeiden rakentamisaikaiset vaikutukset työllisyyteen

2022

Hankkeen tavoitteena on ollut määrittää tutkittuun tietoon perustuva viitekehys liikenneinfrastruktuurihankkeiden rakentamisaikaisten työllisyysvaikutusten arviointiin. Liikenneinfrastruktuurihankkeen rakentamisaikainen bruttomääräinen vaikutus työllisyyteen muodostuu suorasta työpanostarpeesta työmaalla ja välillisestä työpanostarpeesta. Välillinen työpanostarve taaksepäin syntyy rakentamisen välituotevalmistuksessa ja välillinen työpanostarve eteenpäin palkkatulojen synnyttämän kulutuskysynnän lisäyksen kautta. Nettotyöllisyysvaikutus tarkoittaa työllisyysasteen muutosta taloudessa. Silloin huomioidaan rakentamisesta johtuvan työvoiman kysynnän syrjäytysvaikutus jo olemassa oleviin työpai…

transport infrastructureconstructionresearch activitiesliikenneyhteydetresearchtyöllisyysastetyöllisyyspolitiikkaemployment effectstyöllisyysvaikutuksetinfrarakentaminen
researchProduct

Analiza przestrzennego zróżnicowania zmian w potencjale infrastruktury transportowej w Polsce

2015

Wiele zachodzących zjawisk, ich rozwój czy kierunki zmian, uzależnionych jest od przestrzennych interakcji pomiędzy sąsiadującymi regionami. Model przestrzennej analizy shift-share (SSSA) został wprowadzony do badań przez S. Nazarę i G.J.D. Hewingsa. Przedstawia on przestrzennie zmodyfikowane stopy wzrostu (tempa zmian) poszczególnych wariantów zjawiska przez uwzględnienie temp wzrostu zjawiska w obszarach sąsiadujących. Celem artykułu jest analiza zmian struktury infrastruktury transportowej w województwach Polski w latach 2004 oraz 2014, według rodzajów infrastruktury transportowej z zastosowaniem przestrzennej dynamicznej metody przesunięć udziałów. W opracowaniu dokonano oceny tempa wzr…

transport infrastructureprzestrzenna analiza przesunięćinfrastruktura transportowaspatial shift-share analysisZeszyty Naukowe Uniwersytetu Szczecińskiego. Problemy Transportu i Logistyki
researchProduct

LCA of Different Construction Choices for a Double-Track Railway Line for Sustainability Evaluations

2023

The international commitment to achieve carbon neutrality in the next few decades has oriented human activities towards the preservation of natural and non-renewable resources. In this context, a great research effort has been devoted to the search for sustainable solutions for the infrastructure construction sector, based on a thorough assessment of the environmental impact (EI). In this regards, Life Cycle Assessment (LCA) is considered one of the main components of Environmental Impact Assessment (EIA) and, for a comprehensive analysis, all the costs incurred by stakeholders during the useful life of the infrastructure should also be taken into account, applying the Life Cycle Cost (LCC)…

transport infrastructuressoil stabilizationRenewable Energy Sustainability and the EnvironmentLCArecycled materialsGeography Planning and DevelopmentLCCSettore ICAR/04 - Strade Ferrovie Ed AeroportiBuilding and ConstructionManagement Monitoring Policy and LawLCA; LCC; railway; transport infrastructures; recycled materials; soil stabilizationrailwaySustainability
researchProduct

Emergency Response Model as a part of the Smart Society

2021

Centralized hybrid emergency model with predictive emergency response functions is necessary when the purpose is to protect the critical infrastructure (CI). A shared common operational picture among Public Protection and Disaster Relief (PPDR) authorities means that a real-time communication link from the local level to the state-level exists. If a cyberattack would interrupt electricity transmission, telecommunication networks will discontinue operating. Cyberattack becomes physical in the urban and maritime area if an intrusion has not been detected. Hybrid threats require hybrid responses. The purpose of this qualitative research was to find out technological-related fundamental risks …

turvallisuuspalveluttekoälyartificial intelligenceGeneralLiterature_MISCELLANEOUScritical infrastructure protection cyber ecosystem emergency response public protection and disaster relief artificial intelligenceemergency responsecritical infrastructure protectioncyber ecosystempublic protection and disaster relieftoimintavalmius (organisaatiot)infrastruktuuritviranomaisettietoverkotkyberturvallisuusverkkohyökkäyksetvalmiussuunnittelu
researchProduct

More nature in the city

2020

According to projects and practices that the Italian botanists and ecologists are carrying out for bringing “more nature in the city”, new insights for a factual integration between ecological perspectives and more consolidated aesthetic and agronomic approaches to the sustainable planning and management of urban green areas are provided.

urban green areas2019-20 coronavirus outbreak010504 meteorology & atmospheric sciencesCoronavirus disease 2019 (COVID-19)Ecosystem serviceSevere acute respiratory syndrome coronavirus 2 (SARS-CoV-2)Settore BIO/02Ecosystem services green infrastructure human well-being urban biodiversity urban green areasPlant Science010501 environmental sciencesEcosystem services Human well-being Green infrastructure Urban green areas Urban biodiversity01 natural sciencesurban biodiversityEcosystem servicesGreen infrastructure Urban green areaEcosystem servicesEnvironmental planninghuman well-beingEcosystem services; Human well-being; Green infrastructure Urban green areas; Urban biodiversityEcology Evolution Behavior and Systematics0105 earth and related environmental sciencesurban green areaSettore BIO/02 - Botanica SistematicaAmbientaleGeographygreen infrastructureSettore BIO/03 - Botanica Ambientale E ApplicataEcosystem services; green infrastructure; human well-being; urban biodiversity; urban green areasGreen infrastructure
researchProduct