Search results for "ion source"

showing 10 items of 337 documents

The effect of plasma electrode collar structure on the performance of the JYFL 14GHz electron cyclotron resonance ion source

2013

Abstract The influence of a so-called collar structure on the performance of the JYFL 14 GHz electron cyclotron resonance ion source (ECRIS) has been studied experimentally at the Department of Physics, University of Jyvaskyla (JYFL). The collar is a cylindrical structure extruding inwards from the plasma electrode. The collar length was varied between 5 and 60 mm. For some ion species a moderate performance improvement was achieved in terms of extracted beam current and transverse emittance up to 30 mm collar length. Longer collars resulted in a substantial performance decrease. Different collar materials, i.e. nonmagnetic stainless steel, aluminum and Al 2 O 3 , and a wide range of ion sp…

010302 applied physicsPhysicsNuclear and High Energy Physicsta114Plasma01 natural sciences7. Clean energyElectron cyclotron resonanceIon source010305 fluids & plasmasCollarIon0103 physical sciencesElectrodeThermal emittanceddc:530Atomic physicsInstrumentationBeam (structure)
researchProduct

Broadband microwave emission spectrum associated with kinetic instabilities in minimum-B ECR plasmas

2017

Plasmas of electron cyclotron resonance ion sources (ECRISs) are prone to kinetic instabilities due to the resonant heating mechanism resulting in anisotropic electron velocity distribution. Frequently observed periodic oscillations of extracted ion beam current in the case of high plasma heating power and/or strong magnetic field have been proven to be caused by cyclotrontype instabilities leading to a notable reduction and temporal variation of highly charged ion production. Thus, investigations of such instabilities and techniques for their suppression have become important topics in ECRIS research. The microwave emission caused by the instabilities contains information on the electron e…

010302 applied physicsPhysicsRange (particle radiation)microwave sourcesIon sourcesIon beamta114Highly charged ionPlasmaAstrophysics::Cosmology and Extragalactic Astrophysicsplasma instabilitiesmagnetic fieldsCondensed Matter PhysicsPlasma oscillationmagneettikentät01 natural sciences7. Clean energyElectron cyclotron resonanceIonPhysics::Plasma Physicsmicrowave spectra0103 physical sciencesAtomic physics010306 general physicsMicrowave
researchProduct

Time resolved measurements of hydrogen ion energy distributions in a pulsed 2.45 GHz microwave plasma

2017

A plasma diagnostic study of the Ion Energy Distribution Functions (IEDFs) of H+, H+2H2+, and H+3H3+ ions in a 2.45 GHz hydrogen plasma reactor called TIPS is presented. The measurements are conducted by using a Plasma Ion Mass Spectrometer with an energy sector and a quadrupole detector from HIDEN Analytical Limited in order to select an ion species and to measure its energy distribution. The reactor is operated in the pulsed mode at 100 Hz with a duty cycle of 10% (1 ms pulse width). The IEDFs of H+, H+2H2+, and H+3H3+ are obtained each 5 μs with 1 μs time resolution throughout the entire pulse. The temporal evolution of the plasma potential and ion temperature of H+ is derived from the d…

010302 applied physicsPhysicsRange (particle radiation)plasma sourcesta114plasma diagnosticsPlasmaCondensed Matter PhysicsMass spectrometry01 natural sciences7. Clean energyIon source010305 fluids & plasmasIonplasma dynamicsPhysics::Plasma Physics0103 physical sciencesThermal emittancePlasma diagnosticsionAtomic physicsMicrowaveplasma sheathsPhysics of Plasmas
researchProduct

High efficiency resonance ionization of palladium with Ti:sapphire lasers

2016

This work presents the development and testing of highly efficient excitation schemes for resonance ionization of palladium. To achieve the highest ionization efficiencies, a high-power, high repetition rate Ti:sapphire laser system was used and 2-step, 3-step and 4-step schemes were investigated and compared. Starting from different excited steps, the frequencies of the final ionization steps were tuned across the full accessible spectral range of the laser system, revealing several autoionizing Rydberg series, which converge towards the energetically higher lying state of the Pd+ ion ground state configuration. Through proper choice of these excitation steps, we developed a highly efficie…

010302 applied physicsPhysicsResonanceCondensed Matter PhysicsLaser01 natural sciencesAtomic and Molecular Physics and OpticsIon sourcelaw.inventionIonlawIonizationExcited state0103 physical sciencesPhysics::Atomic PhysicsAtomic physics010306 general physicsGround stateExcitationJournal of Physics B: Atomic, Molecular and Optical Physics
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Charge breeding at GANIL: Improvements, results, and comparison with the other facilities

2019

International audience; The 1+/n+ method, based on an ECRIS charge breeder (CB) originally developed at the LPSC laboratory, is now implemented at GANIL for the production of Radioactive Ion Beams (RIBs). Prior to its installation in the middle of the low energy beam line of the SPIRAL1 facility, the 1+/n+ system CB has been modified based on the experiments performed on the CARIBU Facility at Argone National Laboratory. Later, it has been tested at the 1+/n+ LPSC test bench to validate its operation performances. Charge breeding efficiencies as well as charge breeding times have been measured for noble gases and alkali elements. The commissioning phase started at GANIL in the second half-y…

010302 applied physicsPhysicsTest benchRange (particle radiation)mechanical instrumentstutkimuslaitteetCyclotronThermal ionization01 natural sciences7. Clean energyIon source010305 fluids & plasmaslaw.inventionNuclear physicsion sourcesUpgradeBreeder (animal)Beamlinenuclear physicslawion beam mass spectrometer0103 physical sciences[PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]ydinfysiikkaInstrumentation
researchProduct

Hydrogen plasma induced photoelectron emission from low work function cesium covered metal surfaces

2017

Experimental results of hydrogen plasma induced photoelectron emission from cesium covered metal surfaces under ion source relevant conditions are reported. The transient photoelectron current during the Cs deposition process is measured from Mo, Al, Cu, Ta, Y, Ni, and stainless steel (SAE 304) surfaces. The photoelectron emission is 2–3.5 times higher at optimal Cs layer thickness in comparison to the clean substrate material. Emission from the thick layer of Cs is found to be 60%–80% lower than the emission from clean substrates. peerReviewed

010302 applied physicsPhysicsta114HydrogenTantalumAnalytical chemistrytransitionchemistry.chemical_elementSubstrate (electronics)plasmasCondensed Matter Physics01 natural sciencesIon sourcework functions010305 fluids & plasmasion sourceschemistryAluminiumCaesium0103 physical sciencesWork functionLayer (electronics)photoemissionPhysics of Plasmas
researchProduct

Cyclotron instability in the afterglow mode of minimum-B ECRIS.

2016

It was shown recently that cyclotron instability in non-equilibrium plasma of a minimum-B electron cyclotron resonance ion source (ECRIS) causes perturbation of the extracted ion current and generation of strong bursts of bremsstrahlung emission, which limit the performance of the ion source. The present work is devoted to the dynamic regimes of plasma instability in ECRIS operated in pulsed mode. Instability develops in decaying plasma shortly after heating microwaves are switched off and manifests itself in the form of powerful pulses of electromagnetic emission associated with precipitation of high energy electrons. Time-resolved measurements of microwave emission bursts are presented. I…

010302 applied physicsPhysicsta114ta213Astrophysics::High Energy Astrophysical Phenomenaplasma instabilityCyclotronBremsstrahlungPlasma01 natural sciencesInstabilityIon sourceElectron cyclotron resonance010305 fluids & plasmaslaw.inventionTwo-stream instabilityPhysics::Plasma Physicslaw0103 physical scienceselectron cyclotron resonance ion sourcesAtomic physicsInstrumentationIon cyclotron resonanceThe Review of scientific instruments
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Gasdynamic ECR ion source for negative ion production

2018

H− ion sources are needed in various areas of accelerator technology, such as beam injection into cyclotrons and storage rings and as a part of neutral beam injectors for plasma heating in experimental facilities studying thermonuclear fusion. It was recently demonstrated that gasdynamic ion source based on ECR discharge in a simple mirror trap is very efficient for proton beam production [1]. Here we use the gasdynamic plasma source as the first stage driver of volumetric negative ion production through dissociative electron attachment (DEA) [2]. Experiments were performed with a pulsed 37 GHz / up to 100 kW gyrotron radiation in a dual-trap magnetic system, which consists of two identical…

010302 applied physicsThermonuclear fusionMaterials scienceCyclotronElectronPlasma01 natural sciencesIon sourcelaw.inventionIonPhysics::Plasma PhysicslawGyrotron0103 physical sciencesPhysics::Accelerator PhysicsAtomic physics010306 general physicsInstrumentationMathematical PhysicsBeam (structure)Journal of Instrumentation
researchProduct