Search results for "kvanttifysiikka"

showing 10 items of 55 documents

Contour calculus for many-particle functions

2019

In non-equilibrium many-body perturbation theory, Langreth rules are an efficient way to extract real-time equations from contour ones. However, the standard rules are not applicable in cases that do not reduce to simple convolutions and multiplications. We introduce a procedure for extracting real-time equations from general multi-argument contour functions with an arbitrary number of arguments. This is done for both the standard Keldysh contour, as well as the extended contour with a vertical track that allows for general initial states. This amounts to the generalization of the standard Langreth rules to much more general situations. These rules involve multi-argument retarded functions …

Statistics and ProbabilityPhysicsnon-equilibrium Green's functionsFOS: Physical sciencesGeneral Physics and AstronomyStatistical and Nonlinear PhysicsMathematical Physics (math-ph)medicine.disease01 natural sciencesKeldysh formalism010305 fluids & plasmasLangreth rulesModeling and Simulation0103 physical sciencesquantum many-body theorymedicineCalculusParticleKeldysh formalism010306 general physicskvanttifysiikkaMathematical PhysicsCalculus (medicine)
researchProduct

A many-body approach to transport in quantum systems : From the transient regime to the stationary state

2022

We review one of the most versatile theoretical approaches to the study of time-dependent correlated quantum transport in nano-systems: the non-equilibrium Green's function (NEGF) formalism. Within this formalism, one can treat, on the same footing, inter-particle interactions, external drives and/or perturbations, and coupling to baths with a (piece-wise) continuum set of degrees of freedom. After a historical overview on the theory of transport in quantum systems, we present a modern introduction of the NEGF approach to quantum transport. We discuss the inclusion of inter-particle interactions using diagrammatic techniques, and the use of the so-called embedding and inbedding techniques w…

Statistics and ProbabilityTIME-DEPENDENT TRANSPORTKADANOFF-BAYM EQUATIONSGeneral Physics and AstronomyFOS: Physical sciencesnon-equilibrium Green's functionGREENS-FUNCTIONDENSITY-FUNCTIONAL THEORYCondensed Matter - Strongly Correlated ElectronsPhysics - Chemical PhysicsMesoscale and Nanoscale Physics (cond-mat.mes-hall)COHERENT TRANSPORTSINGLE-MOLECULEkvanttifysiikkamany-body correlationMathematical Physicsquantum transportMEAN-FIELD THEORYChemical Physics (physics.chem-ph)Quantum PhysicsANDERSON-HOLSTEIN MODELCondensed Matter - Mesoscale and Nanoscale PhysicsStrongly Correlated Electrons (cond-mat.str-el)Statistical and Nonlinear PhysicsCHARGE MIGRATIONModeling and Simulationnon-equilibrium Green’s functionQuantum Physics (quant-ph)SHOT-NOISE
researchProduct

Distinguishing Majorana Zero Modes from Impurity States through Time-Resolved Transport

2019

We study time-resolved charge transport in a superconducting nanowire using time-dependent Landauer-B{\"u}ttiker theory. We find that the steady-state Majorana zero-bias conductance peak emerges transiently accompanied by characteristic oscillations after a bias-voltage quench. These oscillations are absent for a trivial impurity state that otherwise shows a very similar steady-state signal as the Majorana zero mode. In addition, we find that Andreev bound states or quasi-Majorana states in the topologically trivial bulk phase can give rise to a zero-bias conductance peak, also retaining the transient properties of the Majorana zero mode. Our results imply that (1) time-resolved transport m…

SuperconductivityPhysicsSettore FIS/03Zero modeCondensed Matter - Mesoscale and Nanoscale PhysicssuprajohtavuusCondensed matter physicsPhase (waves)General Physics and AstronomyConductanceFOS: Physical sciencesCharge (physics)Condensed Matter::Mesoscopic Systems and Quantum Hall Effect01 natural sciencesTopological quantum computerPhysics::History of Physics010305 fluids & plasmasMAJORANAnanorakenteet0103 physical sciencesBound stateMesoscale and Nanoscale Physics (cond-mat.mes-hall)kvanttifysiikka010306 general physics
researchProduct

Electronic transport in molecular junctions : The generalized Kadanoff–Baym ansatz with initial contact and correlations

2021

The generalized Kadanoff-Baym ansatz (GKBA) offers a computationally inexpensive approach to simulate out-of-equilibrium quantum systems within the framework of nonequilibrium Green's functions. For finite systems the limitation of neglecting initial correlations in the conventional GKBA approach has recently been overcome [Phys. Rev. B 98, 115148 (2018)]. However, in the context of quantum transport the contacted nature of the initial state, i.e., a junction connected to bulk leads, requires a further extension of the GKBA approach. In this work, we lay down a GKBA scheme which includes initial correlations in a partition-free setting. In practice, this means that the equilibration of the …

Work (thermodynamics)116 Chemical sciencesGeneral Physics and AstronomyNon-equilibrium thermodynamicsFOS: Physical sciencesContext (language use)Electron010402 general chemistry01 natural sciences114 Physical sciencesCondensed Matter - Strongly Correlated ElectronsPhysics - Chemical Physics0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)Statistical physicsPhysical and Theoretical ChemistrykvanttifysiikkaQuantumAnsatzPhysicsChemical Physics (physics.chem-ph)Settore FIS/03Condensed Matter - Mesoscale and Nanoscale Physics010304 chemical physicsStrongly Correlated Electrons (cond-mat.str-el)State (functional analysis)0104 chemical sciencesEmbedding
researchProduct

Tetrahedral chalcopyrite quantum dots in solar-cell applications

2010

We have considered two different chalcopyrite material combinations suggested for intermediate-band solar cell (IBSC) sample fabrication in Helmholtz Zentrum, Berlin. We have obtained the maximum theoretical efficiency values of these two chalcopyrite IBSCs. The optimal sizes of the chalcopyrite quantum dots (QDs) in the corresponding QD-IBSC implementations have been calculated. Optical absorption spectrum of a single chalcopyrite QD has been obtained for both systems. The effect of the QD geometry, especially the effect of the roundness of the QD, was examined. We hope that these results will help in the quest towards more efficient and more affordable solar cells.

aurinkokennotteknologiakvanttifysiikkakvanttipiste
researchProduct

A metageometric enquiry concerning time, space, and quantum physics

2008

avaruusaikakvanttifysiikkametageometria
researchProduct

Fast Green’s Function Method for Ultrafast Electron-Boson Dynamics

2020

The interaction of electrons with quantized phonons and photons underlies the ultrafast dynamics of systems ranging from molecules to solids, and it gives rise to a plethora of physical phenomena experimentally accessible using time-resolved techniques. Green's function methods offer an invaluable interpretation tool since scattering mechanisms of growing complexity can be selectively incorporated in the theory. Currently, however, real-time Green's function simulations are either prohibitively expensive due to the cubic scaling with the propagation time or do neglect the feedback of electrons on the bosons, thus violating energy conservation. We put forward a computationally efficient Gree…

bosonitPropagation timePhotonPhononDegrees of freedom (physics and chemistry)FOS: Physical sciencesGeneral Physics and AstronomyElectronelektronit01 natural sciences7. Clean energy010305 fluids & plasmasCondensed Matter - Strongly Correlated Electronslaskennallinen tiede0103 physical sciencessimulointikvanttifysiikka010306 general physicsfononitBosonPhysicsConservation lawSettore FIS/03Strongly Correlated Electrons (cond-mat.str-el)Computational physicsRelaxation (physics)Physical Review Letters
researchProduct

Time-linear scaling nonequilibrium Green's function methods for real-time simulations of interacting electrons and bosons. I : Formalism

2022

Simulations of interacting electrons and bosons out of equilibrium, starting from first principles and aiming at realistic multiscale scenarios, is a grand theoretical challenge. Here, using the formalism of nonequilibrium Green's functions and relying in a crucial way on the recently discovered time-linear formulation of the Kadanoff-Baym equations, we present a versatile toolbox for the simulation of correlated electron-boson dynamics. A large class of methods are available, from the Ehrenfest to the dressed GD for the treatment of electron-boson interactions in combination with perturbative, i.e., Hartree-Fock and second-Born, or nonperturbative, i.e., GW and T matrices either without or…

bosonitsimulointikvanttifysiikkaelektronit
researchProduct

Experimental snapshot verification of non-Markovianity by quantum probing of convex coefficients

2022

We apply the recently proposed quantum probing protocols with an unknown system-probe coupling to probe the convex coefficients in mixtures of commuting states. By using two reference states instead of one as originally suggested, we are able to probe both the lower and upper bounds for the convex coefficient. We perform extensive analysis for the roles of the parameters characterizing the double peaked Gaussian frequency spectrum in the Markovian-to-non-Markovian transition of the polarization dynamics of a single photon. We apply the probing of the convex coefficient to the transition-inducing frequency parameter and show that the non-Markovianity of the polarization dynamics can be confi…

fotonitpolarisaatio (aaltoliike)kvantti-informaatiokvanttifysiikkaPhysical Review A
researchProduct

Reply to : “Topological and trivial domain wall states in engineered atomic chains”

2022

publishedVersion Non peer reviewed

kiinteän olomuodon fysiikkaCondensed Matter Physicskvanttifysiikka114 Physical sciencesElectronic Optical and Magnetic Materials
researchProduct