Search results for "lääketiede"

showing 10 items of 80 documents

Aerobic Fitness Does Not Modify the Effect of FTO Variation on Body Composition Traits

2012

Purpose Poor physical fitness and obesity are risk factors for all cause morbidity and mortality. We aimed to clarify whether common genetic variants of key energy intake determinants in leptin (LEP), leptin receptor (LEPR), and fat mass and obesity-associated (FTO) are associated with aerobic and neuromuscular performance, and whether aerobic fitness can alter the effect of these genotypes on body composition. Methods 846 healthy Finnish males of Caucasian origin were genotyped for FTO (rs8050136), LEP (rs7799039) and LEPR (rs8179183 and rs1137101) single nucleotide polymorphisms (SNPs), and studied for associations with maximal oxygen consumption, body fat percent, serum leptin levels, wa…

LeptinMaleAnatomy and PhysiologyLiikuntatiede - Sport and fitness sciencesMuscle FunctionsEpidemiologyRespiratory SystemPhysical fitnesslcsh:MedicineCardiovascular SystemBody Mass Indexlcsh:ScienceMusculoskeletal SystemMultidisciplinaryIGF1VO2 maxAdipose TissueGenetic EpidemiologyBody CompositionCirculatory PhysiologyReceptors LeptinMuscleMedicinePublic HealthWaist CircumferenceBehavioral and Social Aspects of HealthResearch ArticleAdultmedicine.medical_specialtyWaistAlpha-Ketoglutarate-Dependent Dioxygenase FTOBiologyPolymorphism Single NucleotideOxygen ConsumptionInternal medicineGeneticsmedicineHumansAerobic exerciseRespiratory PhysiologySports and Exercise MedicineMuscle SkeletalExerciseBiologyGenetic Association StudiesAerobic capacityLeptin receptorbusiness.industrylcsh:RProteinsnutritional and metabolic diseasesHuman Geneticsmedicine.diseaseObesityOikeuslääketiede ja muut lääketieteet - Forensic science and other medical sciencesEndocrinologylcsh:QPreventive MedicinebusinessBody mass indexPLoS ONE
researchProduct

The government medical service and British missions in colonial Malawi, c. 1891–1940 : crucial collaboration, hidden conflicts

2015

MalawisiirtomaahallintoimperiumitlääketiedelähetystyösiirtomaavaltaIso-Britannia
researchProduct

Cardiac Rehabilitees' Technology Experiences Before Remote Rehabilitation : Qualitative Study Using a Grounded Theory Approach

2019

Background: Even though technology is becoming increasingly common in rehabilitation programs, insufficient data are as yet available on rehabilitees’ perceptions and experiences. It is important to understand their abilities when using technology for remote rehabilitation. Objective: This is a qualitative study on technology experiences of persons affected by cardiovascular disease assessed before remote rehabilitation. The aim of the study was to explore rehabilitees’ experiences and attitudes toward technology before 12 months of remote rehabilitation. Methods: Qualitative interviews were conducted with 39 rehabilitees in four focus groups. The subjects were aged 34 to 77 years (average …

Male020205 medical informaticsmedicine.medical_treatmentqualitative studyHealth InformaticsetäpalvelutCoronary Artery Disease02 engineering and technologycoronary diseaserehabilitees’ experienceCoachingGrounded theoryTelerehabilitationHealth care0202 electrical engineering electronic engineering information engineeringmedicineHumansrehabilitees experiencesydäntauditkuntoutujatremote rehabilitationlääkinnällinen kuntoutusQualitative ResearchOriginal PaperMedical educationRehabilitationbusiness.industryRehabilitation counselingta3141ta3142Middle AgedFocus grouptelelääketiedesepelvaltimotautiGrounded Theorye-healthfocus groupFemalekuntoutuse-rehabilitationbusinessPsychologytelerehabilitationsecondary preventionQualitative researchgrounded theory
researchProduct

Evaluation of occupational physical load during 6-month international crisis management operation

2018

Objectives Generally, operational military duties are associated with a variety of stressors, such as prolonged physical activity (PA). However, limited information is available on the occupational workload or changes in PA during international military operations. Thus, the aim of the study was to investigate the changes in body composition, stress biomarkers, PA, and heart rate (HR) responses of 79 male soldiers during a 6-month international crisis management operation. Material and Methods Measurements were conducted 3 times in South-Lebanon during the operation. Body composition was assessed by the bioelectrical impedance method. Blood samples were analyzed for serum testosterone, sex-…

MaleSalivaHydrocortisone0211 other engineering and technologieslcsh:Medicine02 engineering and technologyworkload0302 clinical medicineSex hormone-binding globulinHeart RateSex Hormone-Binding GlobulinTestosteronesotilaatLebanonta315TestosteroneFinlandphysical exertionbiologyGeneral Medicineta3142Body CompositionBioelectrical impedance analysisWorking environmentAdultmedicine.medical_specialtyfyysinen rasitustyömäärä03 medical and health sciencesSomatomedinsStress PhysiologicalInternal medicineHeart ratemedicineaccelerometryHumanssotilaslääketiedeExertionSalivaExercise021110 strategic defence & security studiesbusiness.industrytyöterveysrauhanturvaajatlcsh:RPublic Health Environmental and Occupational Health030229 sport sciencesfyysinen kuormittavuusEndocrinologyPhysical loadsotilashenkilöstöoccupational healthbiology.proteinPhysical therapymilitary personnelalpha-Amylasesbusinessmilitary medicineInternational Journal of Occupational Medicine and Environmental Health
researchProduct

Associations of cardiorespiratory fitness, body composition, and blood pressure with arterial stiffness in adolescent, young adult, and middle-aged w…

2022

AbstractFew studies have investigated whether higher cardiorespiratory fitness (CRF) or favourable body composition are related to lower arterial stiffness in women. We therefore investigated the associations of CRF, body fat percentage (BF%), fat free mass index (FFMI), and mean arterial pressure (MAP) with arterial stiffness in 146 women aged 16–58 years. CRF was assessed by a maximal exercise test with respiratory gas analysis either on a cycle ergometer or a treadmill. Aortic pulse wave velocity (PWVao), augmentation index (AIx%), and MAP were assessed by a non-invasive oscillometric device and BF% and FFMI by a bioelectrical impedance or DXA device. CRF was inversely associated with PW…

MultidisciplinaryAdolescentbiomarkerskardiologiabiomarkkeritBlood PressurelääketiedeMiddle AgedPulse Wave Analysisverenkiertomedical researchYoung AdultVascular StiffnessCross-Sectional StudiescardiologyBody CompositioncirculationHumansFemaleScientific reports
researchProduct

A Smartphone App to Promote Healthy Weight Gain, Diet, and Physical Activity During Pregnancy (HealthyMoms): Protocol for a Randomized Controlled Tri…

2019

BACKGROUND: Excessive gestational weight gain is common and associated with adverse outcomes both in the short and long term. Although traditional lifestyle-based interventions have shown to mitigate excess gestational weight gain, little is known about whether mobile Health (mHealth) apps can promote healthy weight gain, diet, and physical activity during pregnancy. OBJECTIVE: The primary aim of the HealthyMoms trial is to determine the effectiveness of a smartphone app (HealthyMoms) for mitigating excess gestational weight gain during pregnancy. Secondary aims are to determine the effectiveness of the app on dietary habits, physical activity, body fatness, and glycemia during pregnancy. M…

Original Papermobile phoneNutrition and DieteticsexercisekuntoliikuntaraskaussmartphonepainonhallintatelelääketiedeNäringsläragestational weight gainmobiilisovelluksettelemedicinepregnancyteleterveydenhuoltodietJMIR Research Protocols
researchProduct

Poly(alkylidenimine) Dendrimers Functionalized with the Organometallic Moiety [Ru(η5-C5H5)(PPh3)2]+ as Promising Drugs Against Cisplatin-Resistant Ca…

2018

Here and for the first time, we show that the organometallic compound [Ru(&eta

Pharmaceutical Sciencecisplatin01 natural sciencesAnalytical ChemistrydendrimersCoordination ComplexesDrug DiscoveryMoietyplatinummetallitta116Molecular StructureChemistrymolekyylitnanomedicineNanomedicineChemistry (miscellaneous)MCF-7 CellsMolecular MedicineplatinaDendrimersEpithelial-Mesenchymal TransitionCell SurvivalAntineoplastic Agents.myrkyllisyys010402 general chemistryArticlecancer treatmentlcsh:QD241-441Faculdade de Ciências Exatas e da Engenharialcsh:Organic chemistryDendrimerCell Line TumorOrganometallic CompoundsHumansPhysical and Theoretical ChemistryrutheniumPlatinumCell ProliferationTumor microenvironmentCancer och onkologiToxicitynanocarrierssyöpähoidot010405 organic chemistryOrganic ChemistryMesenchymal stem celltoxicityMesenchymal Stem CellsCombinatorial chemistrykantasolutnanolääketiede0104 chemical scienceslääkkeetTumor progressionCell cultureDrug Resistance NeoplasmmetallodrugsCancer and OncologyCancer cellNanocarriersCaco-2 CellsDrug Screening Assays Antitumor<i>cisplatin</i>hMSCs
researchProduct

Jumalan kunniaksi ja ihmisten hyväksi : lääkäri, luonnontieteilijä ja keräilijä Sir Hans Sloane (1660-1753) British Museumin perustajana

1999

Sloane HanstieteetmuseotkeräilyBritish Museumlääketiedehistoriakuriositeettivallankumoukset
researchProduct

Haemoglobin, iron status and lung function of adolescents participating in organised sports in the Finnish Health Promoting Sports Club Study

2020

ObjectivesTo compare laboratory test results and lung function of adolescent organised sports participants (SP) with non-participants (NP).MethodsIn this cross-sectional study, laboratory tests (haemoglobin, iron status), and flow-volume spirometry were performed on SP youths (199 boys, 203 girls) and their NP peers (62 boys, 114 girls) aged 14–17.ResultsHaemoglobin concentration &lt;120/130 g/L was found in 5.8% of SP and 5.1% NP (OR 1.20, 95% CI 0.54 to 2.68). Ferritin concentration below 15 µg/L was found in 22.7% of both SP and NP girls. Among boys ferritin &lt;30 µg/L was found in 26.5% of SP and 30.2% of NP (OR 0.76, 95% CI 0.40 to 1.47). Among SP iron supplement use was reported by 3…

SpirometryPediatricsmedicine.medical_specialtyMedicine (General)AdolescentferritiiniShort ReportPhysical Therapy Sports Therapy and Rehabilitation03 medical and health sciences0302 clinical medicineR5-920nuoretSports & exercise medicineastmamedicineliikuntalääketiedehemoglobiiniOrthopedics and Sports Medicineiron metabolism030212 general & internal medicineLung functionsports & exercise medicineAsthmamedicine.diagnostic_testbusiness.industry030229 sport sciencesIron deficiencyasthmamedicine.diseaseIron metabolism3142 Public health care science environmental and occupational healthAsthmaLaboratory testadolescentClubIron statusbusinessurheilijatBMJ Open Sport — Exercise Medicine
researchProduct

Tarpeita terveydenhuollossa : Unitarian Service -komitean avustusmatkat Saksaan, Italiaan ja Suomeen vuonna 1948

2014

Unitarian Service- komitea on unitaarien Yhdysvalloissa vuonna 1940 perustama kristillinen avustusjärjestö, joka on toteuttanut useita avustusmatkoja Eurooppaan toisen maailmansodan jälkeen. Useat matkat keskittyivät ruoka- ja vaateavun lisäksi kohdemaiden terveydenhuoltojärjestelmään tutustumiseen ja siinä esiintyneiden puutteiden ja epäkohtien kohentamiseen. Vuonna 1948 järjestö toteutti mittavat avustusmatkat Saksaan, Italiaan ja Suomeen, joiden terveydenhuolto-olot ja avustustyöntekijöiden niistä esittämät havainnot ovat tässä tutkimuksessa tarkastelun keskiössä. Avustusmatkoilta kirjoitettujen raporttien avulla tutkimuksessa tarkastellaan sitä, kuinka avustusmatkoille lähteneet yhdysva…

avustustoimintatraditiouskonnolliset järjestötkristillinen avustustyöterveydenhuoltomedical missionslääketiedehistorialääketieteen traditiotItaliaSaksaunitaaritsosiaalihistoriaSuomiUnitarian Sevice –komiteatransnationaalisuustiedon sosiaalisen rakentumisen prosessitlääketieteen historialääketieteen sosiaalihistoria
researchProduct