Search results for "liha"

showing 10 items of 620 documents

Hyvä- ja huonokuntoisten lihasaktiivisuus submaksimaalisen juoksun aikana

2004

fyysinen kuntolihasaktiivisuusfyysinen suorituskykykuntojuoksu
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background: The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods: A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of…

fyysinen kuntolihasmassakansanterveysrasvaprosenttibody-mass indexphysical activityskeletal muscle masspainoindeksifyysinen aktiivisuuskehonkoostumus
researchProduct

Fyysisen kunnon ja kehonkoostumuksen yhteydet kehon syvälämpöön palomiehen työnomaisessa suorituksessa

2018

Fyysisesti raskainta palomiehen työtehtävistä on savusukellus- ja raivaustehtävä. Se aiheuttaa suuret vaatimukset hengitys- ja verenkiertoelimistölle ja kuormittuneisuus voi yltää lähelle maksimaalista hapenkulutusta (VO2max). Lisäksi joudutaan kantamaan ja käsittelemään raskaita taakkoja, jolloin lihaksisto ja muut liikuntaelimet joutuvat kovaan rasitukseen. Käytettävä monikerrosvaatetus ja muut suojavarusteet suojaavat ulkoiselta kuumuudelta, mutta voi aiheuttaa ylikuormitusta kehon syvälämmön noustessa. Syvälämmön voimakkaasta noususta voi seurata lämpöuupumus tai jopa lämpöhalvaus. Tutkimuksen tarkoituksena oli saada selville korreloiko kehon syvälämpö kuntotekijöiden ja kehonkoostumuks…

fyysinen kuntosyvälämpökestävyysliikuntalihaskuntopalomiehetlämmönsäätelykehonkoostumus
researchProduct

Comparison of the effects of high-intensity interval running, high-intensity interval circuit training and steady-state running on body composition a…

2015

Introduction. The measurement of body composition is important for several reasons, but nowadays when obesity and overweight are common problems all over the world even more attention should be given to body composition. Excess amount of fat is itself a risk for health, but it also predisposes to many diseases, one of which is diabetes. It has been shown that with regular physical activity and exercise the body composition and body’s glucose regulation can be improved. In common activity guidelines the amount of traditional endurance and resistance training takes hours per week to perform to fill the recommendations. However, since it has been shown that one of the most common reasons for n…

glukoosiglucose tolerancesteady-state trainingintervalliharjoitteluBody compositionhigh-intensity interval trainingkehonkoostumus
researchProduct

Tiedon ja taidon puute estää raskauden aikaista lantionpohjan lihasharjoittelua

2019

harjoitteetlantionpohjan toimintahäiriötlantiolantionpohjan lihasharjoittelulihaksetraskaus
researchProduct

Energy expenditure and substrate utilization during eccentric exercise in obese and diabetics

2008

harjoittelulihavuusenergiankulutusylipaino
researchProduct

Vuorokaudenajan ja harjoitusjärjestyksen vaikutukset hermostolliseen adaptaatioon, lihasvoimaan ja poikkipinta-alaan yhdistetyssä voima- ja kestävyys…

2014

Rytkönen, Tuomas (2015). Vuorokaudenajan ja harjoitusjärjestyksen vaikutukset hermostolliseen adaptaatioon, lihasvoimaan ja poikkipinta-alaan yhdistetyssä voima- ja kestävyysharjoittelussa. Liikuntabiologian laitos, Jyväskylän yliopisto. Valmennus- ja testausopin pro gradu -työ. 91 s. Monissa liikuntasuoritteissa tarvitaan sekä voimaa (V) että kestävyyttä (K). Yhdistetyssä V+K -harjoittelussa kohtuullinen harjoittelun kokonaisvolyymi on avain siihen, että voiman kehittyminen häiriintyy mahdollisimman vähän kestävyysharjoittelusta. Tässä tutkimuksessa V:aa ja K:ttä harjoitettiin 2–2,5 kertaa viikossa. Yksi aikaa säästävä tapa toteuttaa yhdistettyä V+K -harjoittelua on harjoittaa V:aa ja K:tt…

harjoitusjärjestyshermostollinen adaptaatiokestävyysharjoittelupoikkipinta-alayhdistetty voima- ja kestävyysharjoitteluvuorokauden aikavoimaharjoitteluvuorokaudenajatlihasvoimaharjoitusvaste
researchProduct

Advanced biorefinery concepts related to non-wood feedstocks

2018

Agricultural residues, such as wheat straw (Triticum aestivum), okra stalk (Abelmoschus esculentus), and giant miscanthus (Miscanthus × giganteus, a hybrid of M. sinensis and M. sacchariflorus) were investigated to assess their possible consumption for integrated lignocellulosic biorefining. The efficient fractionation and recovery of all important chemical components (cellulose, hemicelluloses, and lignin) of such feedstocks are a prerequisite for realistic biorefinery concepts. Water is one of the most eco-friendly solvents with the highest potential for industrial use, and it is also suitable for full-scale biorefinery purposes. For example, under pressure at elevated temperatures over 1…

hemiselluloosakarboksyylihapotbiomassaaliphatic carboxylic acidsselluloosafood and beveragesalkaline pulpingligninligniinihot-water extractionesikäsittelynon-wood feedstockkasvimateriaalitbiojalostamotuuttomassanvalmistusbiorefining
researchProduct

Developmental associations of actual motor competence and perceived physical competence with health-related fitness in schoolchildren over a four-yea…

2022

The developmental associations between actual motor competence (MC), perceived physical competence (PC), and health-related fitness (HRF) in schoolchildren were investigated over a four-year period. Participants were 1147 (girls 582, boys 565) schoolchildren aged between 11 to 13 years (M = 11.27 ± 0.33 years) in the beginning of the study. Data were collected at five time points in 2017–2021. MC was measured with three product-oriented (i.e., outcome of the movement) motor competence skill tests: side-to-side jump, five-leaps, and throw-catch. PC was assessed with the Physical Self-Perception Profile. HRF was assessed with the 20m shuttle run, curl-up, and push-up tests. The random interce…

hengityselimetfyysinen kuntocardiorespiratory fitnessmuscular fitnessexercisesydänrandom intercept cross-lagged panel modelhealthlihaksetharjoituksetliikuntaterveysApplied PsychologyPsychology of Sport and Exercise
researchProduct

Hermolihasjärjestelmän mukautuminen toistuviin hypertrofistyyppisiin venymis-lyhenemissyklin sisältämiin voimaharjoituksiin

2000

hermo-lihastoimintaEMGlihastoimintavenymis-lyhenemissyklivoimaharjoitteluvoimarefleksithermotoiminta
researchProduct