Search results for "mapping"

showing 10 items of 1508 documents

Local mechanical properties by Atomic Force Microscopy nanoindentations

2008

The analysis of mechanical properties on a nanometer scale is a useful tool for combining information concerning texture organization obtained by microscopy with the properties of individual components- Moreover, this technique promotes the understanding of the hierarchical arrangement in complex natural materials as well in the case of simpler morphologies arising from industrial processes. Atomic Force Microscopy, AFM, can bridge morphological information, obtained with outstanding resolution, to local mechanical properties. When performing an AFM nanoindentation, the rough force curve, i.e., the plot of the voltage output from the photodiode vs. the voltage applied to the piezo-scanner, …

soft materials polymers elastic Young’s modulus nanoscale mapping mechanical propertiesMaterials scienceatomic force microscopynanoindentationIndentationMicroscopyModulusTexture (crystalline)NanoindentationComposite materialPenetration depthElastic modulusViscoelasticity
researchProduct

MULTIVARIATE ANALYSIS OF GULLY-EROSION PROCESS: SUSCEPTIBILITY ASSESSMENT AND TEMPORAL VALIDATION IN A WATERSHED OF NORTH-CENTRAL SICILY, ITALY

2010

soil erosion susceptibility condition gully-erosion unique conditions units mapping units
researchProduct

The Radó–Kneser–Choquet theorem for $p$-harmonic mappings between Riemannian surfaces

2020

In the planar setting the Rad\'o-Kneser-Choquet theorem states that a harmonic map from the unit disk onto a Jordan domain bounded by a convex curve is a diffeomorphism provided that the boundary mapping is a homeomorphism. We prove the injectivity criterion of Rad\'o-Kneser-Choquet for $p$-harmonic mappings between Riemannian surfaces. In our proof of the injecticity criterion we approximate the $p$-harmonic map with auxiliary mappings that solve uniformly elliptic systems. We prove that each auxiliary mapping has a positive Jacobian by a homotopy argument. We keep the maps injective all the way through the homotopy with the help of the minimum principle for a certain subharmonic expressio…

subharmonicityPure mathematicsFUNCTIONALSMINIMIZERSGeneral Mathematicsp-harmonic mappings01 natural sciencesJacobin matriisitMathematics - Analysis of PDEsMaximum principleBOUNDARY-REGULARITYSYSTEMSMAPSRiemannian surface111 MathematicsFOS: MathematicsComplex Variables (math.CV)0101 mathematicsMathematicsCurvatureMathematics - Complex VariablesHomotopy010102 general mathematicsConvex curveHarmonic mapUnit diskHomeomorphismInjective functionEXISTENCEUNIQUENESSmaximum principlecurvature35J47 (Primary) 58E20 35J70 35J92 (Secondary)ELLIPTIC PROBLEMSDiffeomorphismJacobianunivalentAnalysis of PDEs (math.AP)Revista Matemática Iberoamericana
researchProduct

Load-dependent alpha suppression is related to working memory capacity for numbers

2022

Alpha suppression is proposed to reflect a surge in cortical excitability to enhance stimulus processing in working memory. The attenuated state of alpha might reflect the prioritisation of behaviourally relevant information, making it a proxy for working memory functioning. Despite the growing interest in utilising the advancement of brain-based measures to evaluate individuals’ cognitive processes, there was a lack of consistent evidence on the relationship between alpha suppression and working memory performance. To investigate whether interindividual differences in alpha suppression might be related to variability in working memory capacity, we recorded participants’ electroencephalogra…

suorituskykyBrain Mappingalphaneural oscillationskuormitusGeneral NeuroscienceBrainElectroencephalographytyömuistikognitiiviset prosessitaivokuoriMemory Short-TermParietal LobeHumansmuistaminenelectroencephalography (EEG)EEGaivotutkimusNeurology (clinical)aivotMolecular Biologymuisti (kognitio)Developmental BiologyBrain Research
researchProduct

Rossiâ - Polʹša: nesovpadenie pamâtej. Lingvističeskij aspekt

2017

„Memory turn” in the humanities allows to approach old problems from a new perspective. The author argues that the sphere of complicated Russian-Polish relations should be presented as a conflict between two distinct collective memories. The author considers “memory” as strictly interconnected with so called “non-memory” (i.e. as set of facts not related to memory or superseded by it). In principle, collective memory / non-memory can be subjected to linguistic analysis because it is verbalized and therefore it has its different verbal exponents. The author refers back to his concept of “mental geography” developed 20 years ago and argues that a multi-stage process of mapping two national me…

synthetic definitionverbalizationcollective memorylieux de mémoiremappingproper names
researchProduct

Semi-automatic literature mapping of participatory design studies 2006--2016

2018

The paper presents a process of semi-automatic literature mapping of a comprehensive set of participatory design studies between 2006--2016. The data of 2939 abstracts were collected from 14 academic search engines and databases. With the presented method, we were able to identify six education-related clusters of PD articles. Furthermore, we point out that the identified clusters cover the majority of education-related words in the whole data. This is the first attempt to systematically map the participatory design literature. We argue that by continuing our work, we can help to perceive a coherent structure in the body of PD research.

ta113Structure (mathematical logic)Point (typography)Computer scienceProcess (engineering)tekstinlouhinta020206 networking & telecommunications02 engineering and technologyData scienceParticipatory design0202 electrical engineering electronic engineering information engineeringklusterianalyysi020201 artificial intelligence & image processingparticipatory designSemi automaticSet (psychology)Cluster analysisosallistava suunnittelusystematic literature mappingsystemaattiset kirjallisuuskatsauksetclusteringProceedings of the 15th Participatory Design Conference: Short Papers, Situated Actions, Workshops and Tutorial - Volume 2
researchProduct

Research literature clustering using diffusion maps

2013

We apply the knowledge discovery process to the mapping of current topics in a particular field of science. We are interested in how articles form clusters and what are the contents of the found clusters. A framework involving web scraping, keyword extraction, dimensionality reduction and clustering using the diffusion map algorithm is presented. We use publicly available information about articles in high-impact journals. The method should be of use to practitioners or scientists who want to overview recent research in a field of science. As a case study, we map the topics in data mining literature in the year 2011. peerReviewed

ta113kirjallisuuskatsausklusterointiComputer scienceProcess (engineering)Dimensionality reductiondiffuusiokuvausta111Diffusion mapKeyword extractionliterature mappingdiffusion mapKnowledge discovery processLibrary and Information Sciencescomputer.software_genreData scienceField (geography)Computer Science ApplicationsKnowledge extractionTiedonhavaitsemisprosessitiedonlouhintaCluster analysiscomputerWeb scrapingclustering
researchProduct

Strategic choices of Finnish universities in the light of general strategy frameworks

2016

This study examines university strategies from the content perspective. Since the early 1980s, the pressure to adopt strategic management in universities and other higher education institutions has increased because of issues including reduced public funding, pressures and possibilities for internationalization, developments in teaching technologies, and demands for increased accountability to stakeholders. The study employs content analysis and multivariate statistical techniques to examine the written strategies of 13 Finnish universities formulated after the University Act 2010 that aimed at enhancing their competitiveness in the global arena. The studied organizations cover practically …

ta520Value (ethics)multidimensional scalingcontent analysisHigher educationEducationstrategic choicesvisual mapping0502 economics and businessta516Sociologyta512Strategic planningbusiness.industryManagement science05 social sciences050301 educationPublic relationsContent strategysisällönanalyysiInternationalizationContent analysisAccountabilityStrategic managementbusinessstrategy0503 education050203 business & management
researchProduct

CCTVCV: Computer Vision model/dataset supporting CCTV forensics and privacy applications

2022

The increased, widespread, unwarranted, and unaccountable use of Closed-Circuit TeleVision (CCTV) cameras globally has raised concerns about privacy risks for the last several decades. Recent technological advances implemented in CCTV cameras, such as Artificial Intelligence (AI)-based facial recognition and Internet of Things (IoT) connectivity, fuel further concerns among privacy advocates. Machine learning and computer vision automated solutions may prove necessary and efficient to assist CCTV forensics of various types. In this paper, we introduce and release the first and only computer vision models are compatible with Microsoft common object in context (MS COCO) and capable of accurately…

tekninen rikostutkintasovellukset (soveltaminen)datasetsobject detectiontekoälyprivacykameratcomputer visiontietosuojamachine learningkoneoppiminencamerasyksityisyyskameravalvontavideo surveillancekonenäköCCTVmappingkasvontunnistus (tietotekniikka)2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

Implementation of IUCN criteria for the definition of the Red List of Ecosystems in Italy, Plant Biosystems.

2020

The present work is aimed at presenting the data, methods and criteria that are being used for the assessment of ecosystem collapse risk in Italy.

threatsSettore BIO/03 - Botanica Ambientale E Applicataecosystem risk assessmentpotential natural vegetationmapping and assessment ecosystems and their serviceBiodiversity conservation strategieecoregion
researchProduct