Search results for "myocardial infarction."

showing 10 items of 1011 documents

Towards evidence-based management: A nationwide administrative data-based audit of acute myocardial infarction in Latvia

2019

When care for an individual patient is determined by evidence-based medical guidelines, the management of the whole clinical process also needs to be based on evidence. In Latvia, an careful retros...

endocrine systemmedicine.medical_specialtyLeadership and Managementbusiness.industry030503 health policy & servicesHealth PolicyEvidence-based managementAuditmedicine.disease03 medical and health sciences0302 clinical medicinemedicine030212 general & internal medicineMyocardial infarction0305 other medical sciencebusinessIntensive care medicineInternational Journal of Healthcare Management
researchProduct

Intermittent hypobaric hypoxia applicability in myocardial infarction prevention and recovery.

2012

Abstract Intermittent hypobaric hypoxia (IHH) has been the focus of important research in cardioprotection, and it has been associated with several mechanisms. Intermittent hypobaric hypoxia inhibits prolyl hydroxylases (PHD) activity, increasing the stabilization of hypoxia-inducible factor-1 (HIF-1) and activating crucial adaptative genes. It has been hence suggested that IHH might be a simple intervention, which may offer a thoughtful benefits to patients with acute myocardial infarction and no complications. Nevertheless, several doubts exist as to whether IHH is a really safe technique, with little to no complications in post-myocardial infarction patients. Intermittent hypobaric hypox…

endotheliumInfarctionCoronary artery diseasehypobaric chamberrecoverypreventionmedicineHumansMyocardial infarctionhypoxia-inducible factorCardioprotectionAir Pressuremyocardial infarction; prevention; recoverybusiness.industryAltitudeCell Biologymedicine.diseaseThrombosisbody regionsmyocardial infarctionPoint of ViewsHeart failureHypobaric chamberAnesthesiacardioprotectionIschemic Preconditioning MyocardialMolecular MedicineIschemic preconditioningerythropoietinbusiness
researchProduct

Gender-related differences in men and women with ST-segment elevation myocardial infarction and incomplete infarct-related artery flow restoration: a…

2018

Introduction: Little is known about gender-related differences in ST-segment elevation myocardial infarction (STEMI) and incomplete infarct-related artery (IRA) reperfusion after primary percutaneous coronary intervention (pPCI). Aim: To evaluate gender-related differences in clinical characteristics and prognosis in patients with STEMI and incomplete IRA reperfusion after pPCI. Material and methods: From 42,752 STEMI patients hospitalized between 2009 and 2011 in Poland we analyzed a group of 984 (36%) females and 1,746 (64%) males with less than Thrombolysis in Myocardial Infarction (TIMI) grade 3 flow following pPCI. Results: Women were older than men (72.0 ±11.3 vs. 64.0 ±11.7 years; p …

gender-related differencesmedicine.medical_specialtymedicine.medical_treatmentlcsh:Medicine030204 cardiovascular system & hematology03 medical and health sciences0302 clinical medicineInternal medicinemedicine.arteryMedicineST segmentcardiovascular diseases030212 general & internal medicineMyocardial infarctionOriginal Paperbusiness.industrythrombolysis in myocardial infarctionlcsh:RPercutaneous coronary interventionSudden cardiac arrestThrombolysismedicine.diseaseprimary percutaneous coronary interventionHeart failureRight coronary arteryCardiologymedicine.symptomCardiology and Cardiovascular MedicinebusinessTIMIST-segment myocardial infarctionAdvances in Interventional Cardiology
researchProduct

Role of gene polymorphisms IL 10 (-1082 G/A) and TNFa (-308G/A) in susceptibility to acute myocardial infarction in young man.

2011

gene polymorphisms IL10 (-1082 G/A) and TNF a (-308G/A)acute myocardial infarctionSettore MED/05 - Patologia Clinicayoung man.
researchProduct

Nitric oxide metabolites (nitrite and nitrate) in several clinical condition.

2013

We determined the concentration of nitric oxide metabolites (NO2-+NO3-), expressed as NOx, in several clinical conditions. Regarding this, we have examined 25 subjects with arterial hypertension, 41 subjects with chronic kidney disease in conservative treatment, 106 subjects with metabolic syndrome subdivided according to the presence (n = 43) or not (n = 63) of diabetes mellitus, 48 subjects with obstructive sleep apnea syndrome (OSAS), 14 women with systemic sclerosis complicated with Raynaud's phenomenon, 42 dialyzed subjects and 105 young subjects with acute myocardial infarction (AMI). In subjects with arterial hypertension, chronic kidney disease, metabolic syndrome, systemic sclerosi…

inorganic chemicalsAdultMaledialysimedicine.medical_specialtysistemic sclerosiPhysiologykidney diseasemedicine.medical_treatmentNOxNitric OxideAMIRisk FactorsPhysiology (medical)Internal medicineDiabetes mellitusmedicineDiabetes MellitusHumansMyocardial infarctionRenal Insufficiency ChronicDialysisNitritesMetabolic SyndromeNitratesbusiness.industryOSASApneaHematologyrespiratory systemMiddle Agedmedicine.diseaseObstructive sleep apneaEndocrinologyNOx; hypertension; kidney disease; metabolic syndrome; OSAS; sistemic sclerosis; dialysis; AMICardiovascular DiseasesCase-Control StudiesHypertensionCardiologyFemalemedicine.symptomMetabolic syndromeCardiology and Cardiovascular MedicinebusinessHypopneaKidney diseaseClinical hemorheology and microcirculation
researchProduct

Acute and spontaneous coronary thrombosis in non-culprit artery during percutaneous coronary intervention in myocardial infarction with ST-segment el…

2015

lcsh:Diseases of the circulatory (Cardiovascular) systemmedicine.medical_specialtyAcute coronary syndromeTicagrelorCardiac & Cardiovascular Systemsmedicine.medical_treatmentAbciximabArticleSTEMICoronary thrombosisInternal medicinemedicineAbciximabST segmentMyocardial infarctionbusiness.industryPercutaneous coronary interventionPCImedicine.diseaselcsh:RC666-701Conventional PCICardiologyAcute coronary syndromeCardiology and Cardiovascular MedicinebusinessTicagrelorAcute and spontaneous occlusion of LADmedicine.drugIJC Heart & Vasculature
researchProduct

Plasma Viscosity and NLR in Young Subjects with Myocardial Infarction: Evaluation at the Initial Stage and at 3 and 12 Months

2018

In the “Sicilian study on juvenile myocardial infarction,” we had evaluated plasma viscosity (PV) and neutrophil/lymphocyte ratio (NLR) in patients with acute myocardial infarction (AMI) at the age of ⩽45 years. Now, we examined the relationship between these 2 parameters in 120 subjects (109 men and 11 women) aged ⩽45 years with recent AMI. The patients were classified according to the number of cardiovascular risk factors, the electrocardiographic criteria (ST-segment elevation myocardial infarction [STEMI] or non-ST-segment elevation myocardial infarction [NSTEMI]), and the extent of coronary stenosis, evaluated with coronary angiography. On fasting venous blood, we measured PV at the sh…

lcsh:Diseases of the circulatory (Cardiovascular) systemmedicine.medical_specialtySettore MED/09 - Medicina Internabusiness.industryLymphocytefungimedicine.diseaseneutrophil lymphocyte ratiomedicine.anatomical_structurelcsh:RC666-701Internal medicinecardiovascular systemCardiologyMedicineplasma viscosityIn patientcardiovascular diseasesMyocardial infarctionjuvenile myocardial infarctionStage (cooking)Cardiology and Cardiovascular MedicinebusinessPlasma viscosityOriginal ResearchClinical Medicine Insights: Cardiology
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

The Impact of Prescribed Dosage Assumptions on the Evaluation of Adherence and Persistence to Medication in Patients After Acute Myocardial Infarction

2021

Medication adherence is a significant problem in public health. Prescription-level pharmacy databases have great potential for monitoring actual drug adherence patterns at the healthcare system level. Many research papers have reported adherence estimates in different settings and populations. However, comparison between studies is not always straightforward due to different approaches taken when computing adherence. A crucial component to accurately estimate adherence is the availability of days’ supply information for each dispensing event. Reasonable assumptions regarding medication dosage have to be made, when this information is not available. In this study, we evaluate adherence and p…

medicine.medical_specialty020205 medical informaticsbusiness.industryMedication adherencePharmacy02 engineering and technologyDrug adherencemedicine.diseasePersistence (computer science)Defined daily dose0202 electrical engineering electronic engineering information engineeringmedicineIn patientMyocardial infarctionIntensive care medicinebusinessHealthcare system
researchProduct

Comparison of frequency domain measures based on spectral decomposition for spontaneous baroreflex sensitivity assessment after Acute Myocardial Infa…

2021

Abstract The objective of this study is to present a new method to assess in the frequency domain the directed interactions between the spontaneous variability of systolic arterial pressure (SAP) and heart period (HP) from their linear model representation, and to apply it for studying the baroreflex control of arterial pressure in healthy physiological states and after acute myocardial infarction (AMI). The method is based on pole decomposition of the model transfer function and on the following evaluation of causal measures of coupling and gain from the poles associated to low frequency (0.04−0.15 Hz) oscillatory components. It is compared with traditional non-causal approaches for the sp…

medicine.medical_specialty0206 medical engineeringBiomedical EngineeringHealth Informatics02 engineering and technologyAcute myocardial infarctionBaroreflexSettore ING-INF/01 - ElettronicaMatrix decomposition03 medical and health sciences0302 clinical medicineInternal medicinemedicineSpectral analysiscardiovascular diseasesMyocardial infarctionSensitivity (control systems)Spectral decompositionbusiness.industryHead-up tiltLinear modelBaroreflexmedicine.disease020601 biomedical engineeringFrequency domainCausalityBlood pressureFrequency domainCardiovascular controlSignal ProcessingSettore ING-INF/06 - Bioingegneria Elettronica E InformaticaCardiologybusiness030217 neurology & neurosurgery
researchProduct