Search results for "oration"

showing 10 items of 2042 documents

Atomic Layer Deposition and Properties of Lanthanum Oxide and Lanthanum-Aluminum Oxide Films

2006

Atomic layer deposition (ALD) of lanthanum oxide on glass and silicon substrates was examined using lanthanum silylamide, La[N(SiMe 3 ) 2 ] 3 , and water as precursors in the substrate temperature range of 150-250 °C. The effect of pulse times and precursor evaporation temperature on the growth rate and refractive index was investigated. The films remained amorphous regardless of the deposition conditions. The resulting La 2 O 3 films contained noticeable amounts of hydrogen and silicon and were chemically unstable while stored in ambient air. Lanthanum aluminum oxide films were achieved with stoichiometry close to that of LaAlO 3 at 225°C from La[N(SiMe 3 ) 2 ] 3 , Al(CH 3 ) 3 , and H 2 O.…

010302 applied physicsLanthanideSiliconProcess Chemistry and TechnologyInorganic chemistrychemistry.chemical_element02 engineering and technologySurfaces and InterfacesGeneral ChemistrySubstrate (electronics)021001 nanoscience & nanotechnology01 natural sciencesEvaporation (deposition)Amorphous solidAtomic layer depositionchemistry.chemical_compoundchemistryLanthanum oxide0103 physical sciencesLanthanum0210 nano-technologyChemical Vapor Deposition
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Contrasting topologies for regular interconnection networks under the constraints of nanoscale silicon technology

2010

Nowadays, system designers have adopted Networks-on-Chip as communication infrastructure of general-purpose tile-based Multi-Processor System-on-Chip (MPSoC). Such decision implies that a certain topology has to be selected to efficiently interconnect many cores on the chip. To ease such a choice, the networking literature offers a plethora of works about topology analysis and characterization for the off-chip domain. However, theoretical parameters and many intuitive assumptions of such off-chip networks do not necessarily hold when a topology is laid out on a 2D silicon surface. This is due to the distinctive features of silicon technology design pitfalls. This work is a first milestone t…

010302 applied physicsTopology exploration; Network-on-ChipInterconnectionComputer sciencebusiness.industryDistributed computingLogical topologyTopology explorationTopology (electrical circuits)02 engineering and technologyMPSoCNetwork topology01 natural sciencesPipeline (software)020202 computer hardware & architectureNetwork on a chip0103 physical sciences0202 electrical engineering electronic engineering information engineeringNetwork-on-ChipbusinessDesign technologyComputer network
researchProduct

Comparison of gap-filling techniques applied to the CCI soil moisture database in Southern Europe

2021

Abstract Soil moisture (SM) is a key variable that plays an important role in land-atmosphere interactions. Monitoring SM is crucial for many applications and can help to determine the impact of climate change. Therefore, it is essential to have continuous and long-term databases for this variable. Satellite missions have contributed to this; however, the continuity of the series is compromised due to the data gaps derived by different factors, including revisit time, presence of seasonal ice or Radio Frequency Interference (RFI) contamination. In this work, the applicability of different gap-filling techniques is evaluated on the ESA Climate Change Initiative (CCI) SM combined product, whi…

010504 meteorology & atmospheric sciencesDatabaseCorrelation coefficient0208 environmental biotechnologySoil ScienceGeology02 engineering and technologycomputer.software_genre01 natural sciencesNormalized Difference Vegetation Index020801 environmental engineeringRandom forestSupport vector machineAutoregressive modelPrincipal component analysisPotential evaporationComputers in Earth Sciencescomputer0105 earth and related environmental sciencesMathematicsInterpolationRemote sensingRemote Sensing of Environment
researchProduct

Trends in global research in deforestation. A bibliometric analysis

2018

The main aim of this study was to analyse topics of research, scientific production, collaboration among countries, and most cited papers on deforestation through a bibliometric and social network study of articles found in the Web of Science database. The most productive subject areas corresponded to Environmental Sciences, Ecology and Environmental Studies. The articles were published in 458 different journals. A total of 2051 research articles were obtained. The main challenges identified for deforestation include “land use change” “conservation” “climate change” “rain forest” and “reducing emissions from deforestation and degradation”. Social and economic topics are understudied. An imp…

010504 meteorology & atmospheric sciencesEcology (disciplines)Geography Planning and DevelopmentClimate change010501 environmental sciencesManagement Monitoring Policy and LawScientific research01 natural sciencesAmazoniaDeforestationRegional sciencemedia_common.cataloged_instanceLand use land-use change and forestryDeforestationEuropean union0105 earth and related environmental sciencesNature and Landscape Conservationmedia_commonSocial networkSubject areasAmazon rainforestbusiness.industryForestryInternational collaborationEnvironmental studiesbusinessLand Use Policy
researchProduct

Soil evaporation monitoring : a possible synergism of microwave and infrared remote sensing

1995

Abstract Microwave remote sensing allows the measurement of the water content (θs) at the soil surface within a layer of a few centimetres. When combined with climatic data, θs is a relevant quantity to estimate the evaporation of bare soils. The implementation of a simple daily evaporation (Ed) model on bare soils based on a knowledge of θs is analysed. In order to cover a wide range of soil, soil moisture and climatic conditions, the analysis was carried out on a set of data simulated by a mechanistic model of heat and water flows in the soil. Propagation error analysis on the inputs (θs, daily potential evaporation and wind velocity) of the simple model shows that an accuracy of ± 1.5 mm…

010504 meteorology & atmospheric sciencesMoisture[SDV]Life Sciences [q-bio]0207 environmental engineeringEvaporationSoil science02 engineering and technologySoil type01 natural sciencesPhysics::Geophysics[SDV] Life Sciences [q-bio]Soil waterPotential evaporationEnvironmental sciencePrecipitation020701 environmental engineeringWater contentPhysics::Atmospheric and Oceanic PhysicsMicrowaveComputingMilieux_MISCELLANEOUS0105 earth and related environmental sciencesWater Science and TechnologyRemote sensing
researchProduct

Intact seismic-scale platforms and ramps in the Lower to Middle Jurassic of Morocco: implications for stratal anatomy and lithofacies partitioning.

2017

9 pages; International audience; The Jurassic carbonate platforms of the central High Atlas in Morocco are well known for several high-quality outcrops. In the central High Atlas, there are two complementary locations that offer critical lessons for our understanding of Jurassic carbonate system evolution in extensional basins: a Lower Jurassic high-relief, carbonate platform with steep slopes that developed on the footwall of a rotating fault block in an active half-graben (Djebel Bou Dahar [DBD]) and an upper Lower to Middle Jurassic low-angle prograding carbonate ramp rich in ooids (Amellago ramp [AR]). The DBD and AR outcrops provide superbly exposed, structurally intact, and fully acce…

010506 paleontologyRiftCarbonate platformOutcropEnergy Engineering and Power TechnologyGeology010502 geochemistry & geophysics[ SDU.STU.ST ] Sciences of the Universe [physics]/Earth Sciences/Stratigraphy01 natural sciencesSedimentary depositional environmentchemistry.chemical_compoundPaleontologyFuel TechnologychemistryGeochemistry and Petrology[SDU.STU.ST]Sciences of the Universe [physics]/Earth Sciences/StratigraphyFaciesEarth and Planetary Sciences (miscellaneous)CarbonateFault blockHydrocarbon explorationGeology0105 earth and related environmental sciences
researchProduct

Quartz OSL dating of late quaternary Chinese and Serbian loess: A cross Eurasian comparison of dust mass accumulation rates

2019

© 2018 Elsevier Ltd and INQUA. Reconstructing dust Mass Accumulation Rate (MAR) from loess deposits is critical to understanding past atmospheric mineral dust activity and requires accurate independent age models from loess deposits across Europe and Asia. Previous correlations of loess in Europe and China have tended to focus on multi-millennial timescales, with no detailed examination of dust MAR at the two ends of the Eurasian loess belt on shorter, sub-orbital scales. Here we present a detailed quartz optically stimulated luminescence (OSL) chronology from the Serbian Titel Loess Plateau (Veliki Surduk loess core) and the Chinese Loess Plateau (Lingtai section). The luminescence ages pa…

010506 paleontologyTitel loess plateau010504 meteorology & atmospheric sciencesOptically stimulated luminescenceOSL datingGeochemistryLoessDustMars Exploration ProgramMineral dust01 natural sciencesMARLoessChinese Loess PlateauGlacial periodQuaternary[PHYS.ASTR]Physics [physics]/Astrophysics [astro-ph]QuartzGeologyComputingMilieux_MISCELLANEOUS0105 earth and related environmental sciencesEarth-Surface ProcessesChronology
researchProduct

Condition-dependent effects of corticosterone on a carotenoid-based begging signal in house sparrows

2008

International audience; Begging is a complex display involving a variety of different visual and auditory signals. Parents are thought to use these signals to adjust their investment in food provisioning. The mechanisms that ensure the honesty of begging displays as indicators of need have been recently investigated. It has been shown that levels of corticosterone (Cort), the hormone released during the stress response, increase during food shortage and are associated with an increased begging rate. In a recent study in house sparrows, although exogenous Cort increased begging rate, parents did not accordingly adjust their provisioning rate. Here, we tested the hypothesis that Cort might af…

0106 biological sciences01 natural sciencesNesting BehaviorFight-or-flight responseBehavioral Neurosciencechemistry.chemical_compoundEndocrinologyCorticosteroneAdaptation PsychologicalBeggingpolycyclic compoundsHouse sparrowCarotenoidchemistry.chemical_classificationCarotenoid0303 health sciencesFlange colorationPigmentationPoor body conditionhumanities[ SDE.MCG ] Environmental Sciences/Global ChangesSparrowshormones hormone substitutes and hormone antagonistsmedicine.medical_specialtyendocrine system[SDE.MCG]Environmental Sciences/Global ChangesParent–offspring conflictBiologyAffect (psychology)010603 evolutionary biology03 medical and health sciencesInternal medicinemedicinePasser domesticusAnimalsImmune responseCondition dependent030304 developmental biologyMouth[ SDE.BE ] Environmental Sciences/Biodiversity and EcologyEndocrine and Autonomic SystemsFeeding BehaviorCarotenoids[SDE.ES]Environmental Sciences/Environmental and SocietyAnimal CommunicationEndocrinologychemistryImmune SystemBody ConstitutionParent–offspring conflict[SDE.BE]Environmental Sciences/Biodiversity and EcologyFood DeprivationCorticosteronePhotic Stimulation[ SDE.ES ] Environmental Sciences/Environmental and Society
researchProduct

Letter to the editor regarding the article “Taking advantage of seagrass recovery potential to develop novel and effective meadow rehabilitation meth…

2020

Alagna et al. (2019) suggest new transplantation methods for Posidonia oceanica (Linnaeus) Delile, inspired by its natural recovery process after disturbance due to dredging operations for gas-pipelines. They observe that P. oceanica vegetative fragments naturally settled only on loose calcareous stones deployed to fill the trenches of the gas-pipeline. No recovery was noted on dead matte, sand and large calcarenitic boulders. Following a new pilot restoration project currently ongoing in the same area, we demonstrate that natural recovery also occurs on dead matte. After examining other alternative transplantation methods for P. oceanica, the Authors suggest using their "habitat enhancemen…

0106 biological sciences010501 environmental sciencesAquatic ScienceOceanography01 natural sciencesDredgingMarine pollutionMediterranean SeaEcosystemEnvironmental Restoration and Remediation0105 earth and related environmental sciencesAlismatalesbiology010604 marine biology & hydrobiologyEnvironmental restorationbiology.organism_classificationEcological engineeringGrasslandPollutionFisheryTransplantationSeagrassHabitatPosidonia oceanicaRestoration Substrate Ecological engineering Posidonia oceanicaEnvironmental scienceMarine Pollution Bulletin
researchProduct