Search results for "rake"

showing 10 items of 866 documents

The Waves of Time Revisited : Glimpses of life

2022

This study could perhaps be characterized as the art of walking in time, verbally, pictorially and abstractly, i.e. using words, images and thoughts. Of course, the ideal of essayism also includes a scientific dimension. Equally the aim is to make multi-level use of the idea of dialogue. At the same time, the writer is also carrying on a monologue (with himself), an aspect that is called dialogic monologue. After all, the respondent, too, is himself the questioner. Architecture and the essay are reminiscent of each other. The created building and the created word are close relatives. An essayistic study signifies a hermetic state of language. A text’s inner verbal room is constructed from a…

esseetAino and Alvar Aaltokotifunctionalismfunktionalismiarkkitehtuuriasuinrakennuksettilaarkkitehditpaikkaessayismvalokuvatspirit of the place
researchProduct

Towards powerful old age : association between hormone replacement therapy and skeletal muscle

2010

estrogeenitnaisetrakenneagingcandidate geneKaksostutkimuslihaksethormone replacement therapyikääntyminengene expressionliikuntakykyhormonihoitoskeletal muscletwin studylihaskuntoikääntyneetestrogensmuscle weaknesslihasvoima
researchProduct

Catalytic activity of palladium-based nanostructures in the conversion of simple olefinic hydro- and chlorohydrocarbons from first principles

2011

eteenikatalyytitnanorakenteetkatalyysinanostructuresethylenehydrocarbonshiilivedytcatalyst
researchProduct

Nostalgiaan kätkeytyvät evakkokokemukset

2017

evakotmuseotjälleenrakentaminenSuomen AsutusmuseoMure Yrjösiirtoväki
researchProduct

Optimising the effects of physical activity on mental health and wellbeing: A joint consensus statement from Sports Medicine Australia and the Austra…

2023

Objectives Participation in physical activity can improve mental health and well-being, but effects are mixed. This consensus statement from Sports Medicine Australia and the Australian Psychological Society aims to provide guidance to practitioners on the ways that physical activity can be promoted to maximise benefits to mental health. Method Following the Clinical Consensus Statement protocol, an expert group comprised of eight members with expertise in physical activity and mental health articulated recommendations regarding five physical activity contextual factors: type, physical environment, delivery, domain, and social environment. Results To optimise the mental health benefits of p…

exerciserakennettu ympäristöcontextual factorssuosituksetPhysical Therapy Sports Therapy and Rehabilitationfyysinen ympäristöliikuntabuilt environmentterveyden edistäminensocial environmenthenkinen hyvinvointimielenterveyssosiaalinen ympäristöOrthopedics and Sports Medicineinstructional styleleisure activitiesfyysinen aktiivisuusJournal of Science and Medicine in Sport
researchProduct

Ahti Rytkönen ekspressiivisanatutkijana : oppihistoriallinen katsaus ekspressiivisanatutkimukseen.

1999

fennistiikkakielentutkimuksen alueetJyväskylän kasvatusopillinen korkeakoulusanastoetymologiakielen rakenneekspressiivisanatekspressiivisanastotutkimusleksikologiaRytkönen Ahti
researchProduct

Jean Bodin ja biopolitiikka

2022

Kirjoitus perustuu väitöstilaisuudessa pidettyyn lektioon.   

filosofitEmbryologyFoucault MichelaatehistoriasuvereniteettiCell BiologybiopolitiikkaAnatomyBodin JeanvaltarakenteetvaltaDevelopmental BiologyPolitiikka
researchProduct

Rehabilitation of two northern river lamprey (Lampetra fluviatilis) populations impacted by various anthropogenic pressures : lessons learnt in the p…

2019

The pioneering work done during the past three decades in the regulated Rivers Perhonjoki and Kalajoki, Finland, to study and rehabilitate river lamprey populations is presented. The effects of various anthropogenic activities and rehabilitation measures are evaluated based on habitat surveys and long-term monitoring of larval densities, numbers of adults migrating upstream and of transformers migrating downstream. Telemetric tracking and tagging experiments were used to determine the efficacy of fishways. Lamprey populations in both rivers decreased in the 1980s and 1990s. This was linked to obstructed upstream migration of adults and deterioration of habitats for different life stages due…

fishhabitat managementriveristutus (eläimet)nahkiainendredgingerosionKalajoki (joki)vesirakennusPerhonjokihydropower recoverykunnostuselinympäristölyhytaikaissäännöstelykalatiet
researchProduct

Synthesis, structure and photophysical properties of a highly luminescent terpyridine-diphenylacetylene hybrid fluorophore and its metal complexes

2014

A new fluorescent terpyridyl-diphenylacetylene hybrid fluorophore 4'-[4-{(4-methoxyphenyl)ethynyl}phenyl]-2,2':6',2''-terpyridine, L, was synthesized via Sonogashira cross-coupling of 4'-(4-bromophenyl)-2,2':6',2''-terpyridine and 4-ethynylanisole in the presence of Pd(PPh3)4/CuI as a catalyst. The solid state structure of L shows a trans arrangement of pyridine nitrogen atoms along the interannular bond in the terpyridine domain. Five transition metal complexes of L, {[FeL2](CF3SO3)2 (1), [ZnL2](ClO4)2 (2), [CdL2](ClO4)2 (3), [RuL2](PF6)2 (4), and PtMe3IL (5)}, have also been synthesized and characterized by spectroscopic methods and single crystal X-ray analysis. The X-ray crystal structu…

fluorophoreDenticityterpyridiinisynthesisQuantum yieldmetal complexesCrystal structure010402 general chemistryPhotochemistry01 natural sciencesInorganic Chemistrycrystal structureschemistry.chemical_compoundPyridineta116Diphenylacetylenephotophysical properties010405 organic chemistryLigandterpyridinekiderakenteet0104 chemical sciencesCrystallographyfluoroforitchemistryIntramolecular forcevalofysikaaliset ominaisuudetTerpyridinevalmistusmetallikompleksitDalton Transactions
researchProduct

Synthesis, structure and photophysical properties of a highly luminescent terpyridine-diphenylacetylene hybrid fluorophore and its metal complexes

2015

A new fluorescent terpyridyl-diphenylacetylene hybrid fluorophore 4′-[4-{(4-methoxyphenyl)ethynyl}phenyl]-2,2′:6′,2′′-terpyridine, L, was synthesized via Sonogashira cross-coupling of 4′-(4-bromophenyl)-2,2′:6′,2′′-terpyridine and 4-ethynylanisole in the presence of Pd(PPh3)4/CuI as a catalyst. The solid state structure of L shows a trans arrangement of pyridine nitrogen atoms along the interannular bond in the terpyridine domain. Five transition metal complexes of L, {[FeL2](CF3SO3)2 (1), [ZnL2](ClO4)2 (2), [CdL2](ClO4)2 (3), [RuL2](PF6)2 (4), and PtMe3IL (5)}, have also been synthesized and characterized by spectroscopic methods and single crystal X-ray analysis. The X-ray crystal structu…

fluorophorecrystal structuresfluoroforitterpyridiinivalofysikaaliset ominaisuudetmetal complexessynteesiterpyridinevalmistusmetallikompleksitphotophysical propertieskiderakenteet
researchProduct