Search results for "rings"

showing 10 items of 434 documents

Multialternating Jordan polynomials and codimension growth of matrix algebras

2007

Abstract Let R be the Jordan algebra of k  ×  k matrices over a field of characteristic zero. We exhibit a noncommutative Jordan polynomial f multialternating on disjoint sets of variables of order k 2 and we prove that f is not a polynomial identity of R . We then study the growth of the polynomial identities of the Jordan algebra R through an analysis of its sequence of Jordan codimensions. By exploiting the basic properties of the polynomial f , we are able to prove that the exponential rate of growth of the sequence of Jordan codimensions of R in precisely k 2 .

Numerical AnalysisJordan matrixPolynomialPure mathematicsAlgebra and Number TheoryJordan algebraMathematics::Rings and AlgebrasJordan algebraZero (complex analysis)Polynomial identityExponential growthNoncommutative geometryCodimensionsMatrix polynomialsymbols.namesakeMatrix (mathematics)symbolsDiscrete Mathematics and CombinatoricsGeometry and TopologyMathematicsCharacteristic polynomial
researchProduct

Gradings on the algebra of upper triangular matrices of size three

2013

Abstract Let UT 3 ( F ) be the algebra of 3 × 3 upper triangular matrices over a field F . On UT 3 ( F ) , up to isomorphism, there are at most five non-trivial elementary gradings and we study the graded polynomial identities for such gradings. In case F is of characteristic zero we give a complete description of the space of multilinear graded identities in the language of Young diagrams through the representation theory of a Young subgroup of S n . We finally compute the multiplicities in the graded cocharacter sequence for every elementary G -grading on UT 3 ( F ) .

Numerical AnalysisMultilinear mapPolynomialAlgebra and Number TheoryMathematics::Commutative AlgebraMathematics::Rings and AlgebrasZero (complex analysis)Triangular matrixField (mathematics)Representation theorypolynomial identity G-graded algebras cocharacters graded ideals of identitiesCombinatoricsAlgebraSettore MAT/02 - AlgebraDifferential graded algebraDiscrete Mathematics and CombinatoricsGeometry and TopologyIsomorphismComputer Science::Information TheoryMathematics
researchProduct

BEM-Based Magnetic Field Reconstruction by Ensemble Kálmán Filtering

2022

Abstract Magnetic fields generated by normal or superconducting electromagnets are used to guide and focus particle beams in storage rings, synchrotron light sources, mass spectrometers, and beamlines for radiotherapy. The accurate determination of the magnetic field by measurement is critical for the prediction of the particle beam trajectory and hence the design of the accelerator complex. In this context, state-of-the-art numerical field computation makes use of boundary-element methods (BEM) to express the magnetic field. This enables the accurate computation of higher-order partial derivatives and local expansions of magnetic potentials used in efficient numerical codes for particle tr…

Numerical Analysisbayesian inferenceApplied Mathematicsmittausbayesilainen menetelmäparticle accelerator magnetsmagneettikentätAccelerators and Storage RingsComputing and ComputersComputational Mathematicsmittauslaitteetboundary element methodsmagnetic measurementsfysiikkaMathematical Physics and Mathematicsdata assimilation
researchProduct

A Smartphone App to Promote Healthy Weight Gain, Diet, and Physical Activity During Pregnancy (HealthyMoms): Protocol for a Randomized Controlled Tri…

2019

BACKGROUND: Excessive gestational weight gain is common and associated with adverse outcomes both in the short and long term. Although traditional lifestyle-based interventions have shown to mitigate excess gestational weight gain, little is known about whether mobile Health (mHealth) apps can promote healthy weight gain, diet, and physical activity during pregnancy. OBJECTIVE: The primary aim of the HealthyMoms trial is to determine the effectiveness of a smartphone app (HealthyMoms) for mitigating excess gestational weight gain during pregnancy. Secondary aims are to determine the effectiveness of the app on dietary habits, physical activity, body fatness, and glycemia during pregnancy. M…

Original Papermobile phoneNutrition and DieteticsexercisekuntoliikuntaraskaussmartphonepainonhallintatelelääketiedeNäringsläragestational weight gainmobiilisovelluksettelemedicinepregnancyteleterveydenhuoltodietJMIR Research Protocols
researchProduct

Static output-feedback controller design for vehicle suspensions: an effective two-step computational approach

2014

In this study, a novel two-step methodology is applied in designing static output-feedback controllers for a class of vehicle suspension systems. Following this approach, an effective synthesis of static output-feedback controllers can be carried out by solving two consecutive linear matrix inequality optimisation problems. To illustrate the main features of the proposed design strategy, two different static output-feedback H 8 controllers are designed for a quarter-car suspension system. The first of those controllers uses the suspension deflection and the sprung mass velocity as feedback information, whereas the second one only requires the sprung mass velocity to compute the control acti…

Output feedbackEngineeringFrequency responseControl and Optimization:Informàtica::Automàtica i control [Àrees temàtiques de la UPC]Linear matrix inequalitiesVehicle suspensionsDesign strategyControl and Systems Engineering; Human-Computer Interaction; Computer Science Applications1707 Computer Vision and Pattern Recognition; Control and Optimization; Electrical and Electronic EngineeringFeedback control systemsMatrius (Matemàtica)Vehicles -- Ressorts i suspensió:93 Systems Theory; Control [Classificació AMS]Control theoryDeflection (engineering)ControlElectrical and Electronic EngineeringMatrix inequalitiesSuspension (vehicle)Controller design:93 Systems Theory [Classificació AMS]Vehicles--Springs and suspensionbusiness.industryLinear matrix inequality:Matemàtiques i estadística [Àrees temàtiques de la UPC]Control engineeringComputer Science Applications1707 Computer Vision and Pattern RecognitionVehicles -- Springs and suspensionComputer Science ApplicationsHuman-Computer InteractionControl and Systems EngineeringSistemes de control per retroaccióSprung massbusinessStatic output-feedback control
researchProduct

Static output-feedback control for vehicle suspensions: a single-step linear matrix inequality approach

2013

In this paper, a new strategy to design static output-feedback controllers for a class of vehicle suspension systems is presented. A theoretical background on recent advances in output-feedback control is first provided, which makes possible an effective synthesis of static output-feedback controllers by solving a single linear matrix inequality optimization problem. Next, a simplified model of a quarter-car suspension system is proposed, taking the ride comfort, suspension stroke, road holding ability, and control effort as the main performance criteria in the vehicle suspension design. The new approach is then used to design a static output-feedbackH∞controller that only uses the suspensi…

Output feedbackEngineeringOptimization problemArticle Subject:Informàtica::Automàtica i control [Àrees temàtiques de la UPC]General MathematicsSingle stepFeedback control systemsMatrius (Matemàtica)Vehicles -- Ressorts i suspensió:93 Systems Theory; Control [Classificació AMS]Deflection (engineering)Control theoryControlMatrix inequalitiesSuspension (vehicle):93 Systems Theory [Classificació AMS]Vehicles--Springs and suspensionbusiness.industrylcsh:MathematicsGeneral EngineeringLinear matrix inequality:Matemàtiques i estadística [Àrees temàtiques de la UPC]Control engineeringlcsh:QA1-939lcsh:TA1-2040Sistemes de control per retroaccióSprung masslcsh:Engineering (General). Civil engineering (General)business
researchProduct

Maiņas punktu noteikšana būvju tehniskā stāvokļa monitoringā datiem uz vibrācijām balstītām metodēm

2022

Inženierzinātņu disciplīnās eksperimentāli iegūtajos laikrindu datos bieži vien ir svarīgi viennozīmīgi un efektīvi identificēt maiņas punktu. Kā piemēram, būvniecības nozarē veicot instumentētu konstrukciju tehnisko monitoringu, kur maiņas punkts var liecināt par konstrukcijas darbības izmaiņu vai bojājumu. Šajā darbā tiek analizētas trīs dažādu algoritmu (galīgo komponenšu analīze, kumulatīvo summu algoritms un robustā maiņas punktu noteikšana ar R pakotni robts) pielietojuma iespējas specifisku datu vidējās vērtības maiņas punktu noteikšanā. Darba ietvaros novērtēts iegūto rezultātu robustums un izstrādātas rekomendācijas šo algoritmu pielietošanai būvniecības nozarē, tai skaitā dažādu a…

PCAbūvju tehniskais monitoringsCUSUMMatemātikamaiņas punktu noteikšana
researchProduct

Mentorings jauno operācijas māsu apmācībā

2020

ANOTACIJA Pētījuma tēma mentorings jauno operācijas māsu apmācība. Tēma ir aktuāla, jo darba tirgus ir ļoti mainīgs un darbinieku plūsma medicīnā ir ļoti strauja. Tāpēc ir ļoti svarīgi lai būtu kvalitatīvi specialisti, kuri ir ieinteresēti sava darba un profesionālajā pilnveidošana. Un kā izdarīt tā, lai jauni specialisti būtu ieinteresēti? Kvalitatīvi tos apmācīt, lai jaunās māsas saprastu, vai šis darbs ir viņām piemērots. Mentoring ir būtisks, it īpaši operācijas masu praksē, jo jaunās māsas nevar iemācīties visas nepieciešamas iemaņas no teorijas. Šajā jomā pieredzes nodošana jauniem specialistiem ir ļoti svarīgā, ne tikai no jauno iemanu iegūšanas puses, bet ari no psihoemocionālās pus…

PROFESIONĀLA MĀSAPRAKSEMENTORINGSOPERĀCĪJAS MĀSAAPMĀCĪBAMedicīna
researchProduct

Searching for Jumbled Patterns in Strings

2009

Parikh vectors permuted strings pattern matching string algorithms average case analysisString algorithmsAverage case analysis; Parikh vectors; Pattern matching; Permuted strings; String algorithmsPermuted stringsParikh vectorsAverage case analysisPattern matching
researchProduct

On Approximate Jumbled Pattern Matching in Strings

2011

Given a string s, the Parikh vector of s, denoted p(s), counts the multiplicity of each character in s. Searching for a match of a Parikh vector q in the text s requires finding a substring t of s with p(t) = q. This can be viewed as the task of finding a jumbled (permuted) version of a query pattern, hence the term Jumbled Pattern Matching. We present several algorithms for the approximate version of the problem: Given a string s and two Parikh vectors u, v (the query bounds), find all maximal occurrences in s of some Parikh vector q such that u <= q <= v. This definition encompasses several natural versions of approximate Parikh vector search. We present an algorithm solving this problem …

Parikh vectors: Average case analysiApproximate searchString algorithmsDiscrete mathematicsWeight functionanalysisSearch engine indexingParikh vectorsAverage case analysisApproximate string matchingSubstringString algorithmTheoretical Computer ScienceCombinatoricsComputational Theory and MathematicsString algorithms Pattern matching Parikh vectors Average case analysis Approximate search Permuted stringsPermuted stringsAverage caseTheory of computationWavelet TreePreprocessorPattern matchingPattern matchingMathematicsTheory of Computing Systems
researchProduct